ORFeome > g6pc – XORFeome 2.0

g6pc – XORFeome 2.0

General Information

Species: Xenopus tropicalis glucose-6-phosphatase, catalytic (glycogen storage disease type I, von Gierke disease), mRNA (cDNA clone MGC:79610 IMAGE:6979551), complete cds
Gene Symbol: g6pc
Gene ID: 448183
ORF gb_acc: MG133633
ORF ID: 11176

ORF full-length analysis tests

Clone type: Putative Full Length
XGC accession: BC075103

Library Location

Plate ID: GDExt11011
Well Location: E07

EST Sequences

Clone: MGC:79610 IMAGE:6979551
Trimmed Sequence: ATGGAGAATAAGATGGATGCTCTCCACCACTCAGGAGTTCAGATGGTGCACTATCTCCAGGTGAACTATGAAACATCCCAAGACTGGTTCGTATTTATCTCCTTCGCGGCTGATCTCAGGAACACTTTTTTTATCCTGTTCCCCATCTGGTTCCATCTGTGTGAGTCGGTGGGGATCAAGCTCATCTGGGTAGCGGTGATCGGCGATTGGCTAAACCTTGTCTTCAAATGGATCCTTTTTGGCCAGAGGCCGTACTGGTGGGTGCACGACACAGACTATTACAACAACATGTCTGCTCCAGTCATACAACAGTTTCCTGTCACCTGTGAGACAGGTCCAGGAAGTCCTTCAGGACATGCCATGGGATCTGCTGGTATCTACTATGTCATAGTCACTGCTCTAGTTACCCTTTTCCTACAGAAAAAACAATCCTTTAGTTTCCAAAAGAAATGTTTTCAAGCCCTGCTGTGGTCTGGTTTCTGGGTGATTCAGGCATGTGTTTGCTTGTCCCGAGTCTTCCTTGCTGCTCACTTTCCACATCAAGTTATCTGTGGAGTCATTGCAGGCATGGTCGTGGCAGAAGTATTTGAACACATCCAATCCATTTACAAAGCCAGCCTGAATAAGTATATATACACTACTCTGTTTCTGTTTTGCTTTGCACTGGGATTTTACCTGGTGTTAAAAACTGTTGGCGTGGACTTGCTGTGGACAATAGAAAAGGCCAAGAGATGGTGCTCCCAACCCGAGTGGATTCATATCGACACAACTCCATTTGCTGGACTTCTTAGGAACCTTGGTATCTTCTTTGGCTTGGGCTTGGCCCTTAACTCGCCAATGTACAAAGACTACTGTCAGGGAAAACAAGGCAGGCACTTCGGCTTTCGCCTCTGCTGTATTATAGCCTCGTTGCTTGTCCTCCACCTATTTGACAGCTTTAAACCACCTACCAAAGTGGAGATGATCTTCTATGCTTTGTCCTTTTGCAAGAGTGCAGCAGTTCCATTGACATGTGTAGCAATAATCCCATACTGTGTATCCCAGATTGTAAACAGGAAAGAGAAAGTTTTATAA
Full Trace Sequence: gaagaagtaaacaaccttcagaagtaagagagatccactgaaatggagaataagatggatgctctccaccactcaggagttcagatggtgcactatctccaggtgaactatgaaacatcccaagactggttcgtatttatctccttcgcggctgatctcaggaacactttttttatcctgttccccatctggttccatctgtgtgagtcggtggggatcaagctcatctgggtagcggtgatcggcgattggctaaaccttgtcttcaaatggatcctttttggccagaggccgtactggtgggtgcacgacacagactattacaacaacatgtctgctccagtcatacaacagtttcctgtcacctgtgagacaggtccaggaagtccttcaggacatgccatgggatctgctggtatctactatgtcatagtcactgctctagttacccttttcctacagaaaaaacaatcctttagtttccaaaagaaatgttttcaagccctgctgtggtctggtttctgggtgattcaggcatgtgtttgcttgtcccgagtcttccttgctgctcactttccacatcaagttatctgtggagtcattgcaggcatggtcgtggcagaagtatttgaacacatccaatccatttacaaagccagcctgaataagtatatatacactactctgtttctgttttgctttgcactgggattttacctggtgttaaaaactgttggcgtggacttgctgtggacaatagaaaaggccaagagatggtgctcccaacccgagtggattcatatcgacacaactccatttgctggacttcttaggaaccttggtatcttctttggcttgggcttggcccttaactcgccaatgtacaaagactactgtcagggaaaacaaggcaggcacttcggctttcgcctctgctgtattatagcctcgttgcttgtcctccacctatttgacagctttaaaccacctaccaaagtggagatgatcttctatgctttgtccttttgcaagagtgcagcagttccattgacatgtgtagcaataatcccatactgtgtatcccagattgtaaacaggaaagagaaagttttataagatgatggcattctctttctttctacattgtgcagtactctacatacatgtatatatggggagtaccatccagagtagagaggacatcccatacttattaataggtctgcactgaagtcaagtttttgctactttcaaagcaagaacatgcaagagatgccttataataggtaacaaacttgaaaataggtcagatcaggaagtaattacaataggactatttattaaaacaaagaatagttataaagtaaatcccattgcacctcagttttggttatctatggggttatctgagtatttttctaaatgccaatatgtaagtgtttgaaggacacattgggttacatttctacggacctatggtgaagggtcattcagagtatttaaaaggtagcatgagtaattctattttatataaggcaacctttttacatgaaggaggtcctactaagtctggctacatttcatactttcaggtgctagagtctgttaatacttgatattagtctataatattattgcaaagtcctctaaactcatgggacattggtgggcagacagtgacagctaacagtgttatttttttgacaattccagccctgtagggagcatgcatgagttttatagattgaggacaagaaatagcccaccaaacatcattagtatatggaacatatcaaggtgtttctaatggataacagtaaagtatggcagacattttcctgggtttattattttgagccctaatatatatatatttttacaaacctctcaggggagactttcattgtcctagttgttttattgtgtggttaattcacagctttgtagctaaattagaagaaaatgtatgtgagatgttgtcagctagaatgtatgggttttttagccttctttttattttgaaacattttaatatcaaagaattatctgatctaaattgtgaatgacagtttagttgttctattggttcatgcaaatattttttttaataaaacattaactgtgaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaa
Translation: MENKMDALHHSGVQMVHYLQVNYETSQDWFVFISFAADLRNTFFILFPIWFHLCESVGIKLIWVAVIGDWLNLVFKWILFGQRPYWWVHDTDYYNNMSAPVIQQFPVTCETGPGSPSGHAMGSAGIYYVIVTALVTLFLQKKQSFSFQKKCFQALLWSGFWVIQACVCLSRVFLAAHFPHQVICGVIAGMVVAEVFEHIQSIYKASLNKYIYTTLFLFCFALGFYLVLKTVGVDLLWTIEKAKRWCSQPEWIHIDTTPFAGLLRNLGIFFGLGLALNSPMYKDYCQGKQGRHFGFRLCCIIASLLVLHLFDSFKPPTKVEMIFYALSFCKSAAVPLTCVAIIPYCVSQIVNRKEKVL
Donor tissue: tailbud