ORFeome > gadd45g – XORFeome 2.0

gadd45g – XORFeome 2.0

General Information

Species: Xenopus tropicalis growth arrest and DNA-damage-inducible, gamma, mRNA (cDNA clone MGC:89481 IMAGE:6991962), complete cds
Gene Symbol: gadd45g
Gene ID: 448442
ORF gb_acc: MG133971
ORF ID: 11569

ORF full-length analysis tests

Clone type: Putative Full Length
XGC accession: BC075545

Library Location

Plate ID: GDExt11015
Well Location: A03

EST Sequences

Clone: MGC:89481 IMAGE:6991962
Trimmed Sequence: ATGACTCTGGAAGAAGTTCACGGACAAGAAACCGTTGTTGAAAGCGCTGACAGGATGCAAACTGCTGGCAAAGCCCTGCATGAACTATTGGTCTCTGCCCAGAGAGAGGAGTGTCTGACCGTTGGAGTCTATGAGTCTGCCAAAGTAATGAATGTAGATCCAGATAGTGTCACTTTCTGCATCTTGGCTGCAGACGAGTACGACGAGGGTGATATAGCCCTTCAGATCCACTTCACTCTGATTCAAGCTTTCTGCTGTGAAAATGACATCAATATCGTGAGGCTGAATGACACAGAAAAAGTAGCTCAAATTCTAGGCTTAACAGATGAGTCTGCAGAGCCCAAGGACCTGCACTGCATCCTTATTACGAATCCAAATGAGGATGCCTGGAAAGATCCAGCCCTGGAGAAACTGGGTATATTCTGTGATGAAAGCCGTAAAGTCTACGACTGGGTTCCCAGTATCACCCTGCCAGAGTGA
Full Trace Sequence: ctaactgctctgaagctactgtggatattatactcttcttcttccggaccctttggtggatatttgagaagtctctcgcactcacatttttgtggcttacccggaaaatcatgactctggaagaagttcacggacaagaaaccgttgttgaaagcgctgacaggatgcaaactgctggcaaagccctgcatgaactattggtctctgcccagagagaggagtgtctgaccgttggagtctatgagtctgccaaagtaatgaatgtagatccagatagtgtcactttctgcatcttggctgcagacgagtacgacgagggtgatatagcccttcagatccacttcactctgattcaagctttctgctgtgaaaatgacatcaatatcgtgaggctgaatgacacagaaaaagtagctcaaattctaggcttaacagatgagtctgcagagcccaaggacctgcactgcatccttattacgaatccaaatgaggatgcctggaaagatccagccctggagaaactgggtatattctgtgatgaaagccgtaaagtctacgactgggttcccagtatcaccctgccagagtgaacatcttttctctacattagattgtaaaatctctgcattattatcatggtgttgtgcacctggatggaccagcagcattccgaagtctgtggattacgctggttgaggtcagattaagtcgccaagactggcaaagatgttggctcttgtggagcagaagagtaaggaggaaaacttaacatggactgatctgtaaaaggaagggttggtgccagtttgaagcctcccaaagcactggggggggggcagtcatgccatggagctggaggagttttgcatgtgctaaaagcaaaaatggaagcttttaagatggatatgaggcaaattaagcagctggttaaaggaaagaacctgttctgtatctgcttttggagtttgctgagatatgaaacatgaactttatatacacattggaagagtctgggactatatagctctggattgcaaactgagactgaattctgttcattgcagcttgttattggttattacagtctactactacagtctactacccagaatacatagtaaaaaaaaaaaaagactttctgtattttcaacattttgacactgttgcaaattgaagtgcttttcttgatgaaacttggcatttaaaatgttgttttctgtcattcaataaatcattttaaatctcaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaa
Translation: MTLEEVHGQETVVESADRMQTAGKALHELLVSAQREECLTVGVYESAKVMNVDPDSVTFCILAADEYDEGDIALQIHFTLIQAFCCENDINIVRLNDTEKVAQILGLTDESAEPKDLHCILITNPNEDAWKDPALEKLGIFCDESRKVYDWVPSITLPE
Donor tissue: neurula