ORFeome > gamt – XORFeome 2.0

gamt – XORFeome 2.0

General Information

Species: Xenopus tropicalis guanidinoacetate N-methyltransferase, mRNA (cDNA clone MGC:75698 IMAGE:5380533), complete cds
Gene Symbol: gamt
Gene ID: 394491
ORF gb_acc: MG132964
ORF ID: 10340

ORF full-length analysis tests

Clone type: Full Length
XGC accession: BC059738

Library Location

Plate ID: GDExt11004
Well Location: B01

EST Sequences

Clone: MGC:75698 IMAGE:5380533
Trimmed Sequence: ATGTCTGAACGGATCTTCATAGAGGGCGAGAGCTGCAAGTCCGCCTGGCACAATGCAACTGCTGGGTACGATGATACCGACACTCACCTGGAGATCCTGGGTAAACCGGTAATGGAGCGATGGGAGACTCCATATATGCACAGTCTGGCTTCGGTAGCGGCCAGCAAGGGTGGCCGTGTGCTGGAGATTGGTTTTGGCATGGCAATTGCAGCTACTAAGTTGGAAGAGTACAATATCGAGGAACACTGGATAATTGAATGCAATGATGGTGTATTCAAGCGGCTTCAAGAATGGGCCACAAAGCAACCACATAAGATTGTGCCATTAAAAGGGCTGTGGGAGGATGTAGTGCCAACATTACCCGATGGACACTTTGATGGGATCCTTTATGACACATACCCTCTTTCCGAAGAAACATGGCACACGCACCAGTTTAACTTTATCAAGGGTCACGCTTATCGGCTGCTTAAACCTGGAGGAGTCCTCACCTACTGCAACCTGACATCTTGGGGTGAACTACTCAAGGCCAAATACAATGACATAGAAAAAATGTTCCAGGAGACTCAGATTCCACAACTAGTGGATGCTGGTTTTAAGTCTGAGAATATTAGTACTACTGTAATGGACCTGATACCCCCCGAGGATTGCAGATACTACTCCTTCAAAAAAATGATCACACCAACCATTATTAAGGTCTGA
Full Trace Sequence: ctttgaacaaccaaatcaatgtctgaacggatcttcatagagggcgagagctgcaagtccgcctggcacaatgcaactgctgggtacgatgataccgacactcacctggagatcctgggtaaaccggtaatggagcgatgggagactccatatatgcacagtctggcttcggtagcggccagcaagggtggccgtgtgctggagattggttttggcatggcaattgcagctactaagttggaagagtacaatatcgaggaacactggataattgaatgcaatgatggtgtattcaagcggcttcaagaatgggccacaaagcaaccacataagattgtgccattaaaagggctgtgggaggatgtagtgccaacattacccgatggacactttgatgggatcctttatgacacataccctctttccgaagaaacatggcacacgcaccagtttaactttatcaagggtcacgcttatcggctgcttaaacctggaggagtcctcacctactgcaacctgacatcttggggtgaactactcaaggccaaatacaatgacatagaaaaaatgttccaggagactcagattccacaactagtggatgctggttttaagtctgagaatattagtactactgtaatggacctgataccccccgaggattgcagatactactccttcaaaaaaatgatcacaccaaccattattaaggtctgagaaacttgagaacctaccttgttaataggaacctagaccctaacagggacaggaatcaaaattgtcaccactggctatctacaaaataattactggatttatctggacctaccacaatatgatagactgtttaaggccatcagggcagagttgcaaagttccattttatacagcaagcactctgctagcgaatgcttaataaaaccatatatatttggaaaaaaaaaaaaaaaaaaaaaaaaa
Translation: MSERIFIEGESCKSAWHNATAGYDDTDTHLEILGKPVMERWETPYMHSLASVAASKGGRVLEIGFGMAIAATKLEEYNIEEHWIIECNDGVFKRLQEWATKQPHKIVPLKGLWEDVVPTLPDGHFDGILYDTYPLSEETWHTHQFNFIKGHAYRLLKPGGVLTYCNLTSWGELLKAKYNDIEKMFQETQIPQLVDAGFKSENISTTVMDLIPPEDCRYYSFKKMITPTIIKV
Donor tissue: tadpole