ORFeome > gfod1 – XORFeome 2.0

gfod1 – XORFeome 2.0

General Information

Species: Xenopus tropicalis glucose-fructose oxidoreductase domain containing 1, mRNA (cDNA clone MGC:75800 IMAGE:5382243), complete cds
Gene Symbol: gfod1
Gene ID: 394777
ORF gb_acc: MG132942
ORF ID: 10312

ORF full-length analysis tests

Clone type: Full Length
XGC accession: BC063342

Library Location

Plate ID: GDExt11003
Well Location: C09

EST Sequences

Clone: MGC:75800 IMAGE:5382243
Trimmed Sequence: ATGCTGCCCGGGGTAGGGGTGTTTGGCACAAGCCTGACATCAAGGGTGATTATCCCCCTGCTGAAGGACGAGGGATTCTCGGTGAAGGCGCTATGGGGAAGGACACAGGAGGAGGCAGAGGAGCTGGCGAAGGAGATGAGCGTCCCTTTCTACACCAACCGCATCGACGATGTTTTGTTGCACCAAGACGTGGATCTGGTGTGCATCAACCTGCCGCCACCGCTCACCAAGCAGATTGCTGTCAAAACCCTGGGTATTGGGAAAAATGTAATTTGTGACCGAACAGCTACCCCCTTGGATGCTTTTAGAATGATGTCAGCTGCACATTATTACCCCAAGCTAATGAGCATCATGGGAAATGTCTTGCGGTTTCTTCCAGCTTTTGTAAAGATGAAGCAGCTAATACAGGAAGGATATGTAGGTGAGCTTCAAGTGTGTGAGGTTCAGGTCCACAGTGGAAGTCTTCTGGGAAAGAAGTACAACTGGAGCTGTGATGATCTCATGGGTGGAGGTGGTCTACACTCCGTGGGGAGCTACATCATTGACTTGCTGACTTTCTTAACCAGCCAGAAAGCTGTGAAGGTTCACGGCCTCTTGAAGACCTTTGTGAAGCAGACAGATCATATAAAAGGGATACGTCAGATTACCAGTGACGATTTTTGTACATTTCAAATGGTGCTAGAGGGAGGGGTGTGCTGCACTGTTACCCTTAACTTTAATGTCCCAGGTGAGTTTAAGCAAGATGTCATTGTTGTAGGCTCAGCTGGCCGACTTATTGTAACAGGGATTGACCTTTATGGACAAAGAAACAGCTCCTCCGATCGTGAATTGCTTTTAAAAGACTCAACCCCTGTCAGCAACTCTCTTTTACCTGAAAAGGCATTTAGTGACATTCCATCCCCATACCTTCGAGGAACTATTAAAATGGTGCAGGCTGTGCGCCAAGCGTTTCAAGACCAGGACGACAGGAGAACATGGGATGGTAGGCCGCTGACCATGGCTGCCACATTTGATGACTGTCTTTATGCTTTGTGCGTAGTTGACACCATTAAGAAATCTAACCAGACTGGTGAATGGCAAAATATTGTGATTATGACTGAAGAACCTGAATTGAGTCCTGCATATTTAATTAGTGAAGCAATGCGCAGAAGCAGAATGTCTTTGTATTGTTAG
Full Trace Sequence: cataggaagagcatttgtattgctgctgttattattaagacttgtggtcccccggaggcgctggcttcctttctgtacagtacacgaagctgcagcacccagctcccttctgcccccagccagggctcagctcagctatgctgcccggggtaggggtgtttggcacaagcctgacatcaagggtgattatccccctgctgaaggacgagggattctcggtgaaggcgctatggggaaggacacaggaggaggcagaggagctggcgaaggagatgagcgtccctttctacaccaaccgcatcgacgatgttttgttgcaccaagacgtggatctggtgtgcatcaacctgccgccaccgctcaccaagcagattgctgtcaaaaccctgggtattgggaaaaatgtaatttgtgaccgaacagctacccccttggatgcttttagaatgatgtcagctgcacattattaccccaagctaatgagcatcatgggaaatgtcttgcggtttcttccagcttttgtaaagatgaagcagctaatacaggaaggatatgtaggtgagcttcaagtgtgtgaggttcaggtccacagtggaagtcttctgggaaagaagtacaactggagctgtgatgatctcatgggtggaggtggtctacactccgtggggagctacatcattgacttgctgactttcttaaccagccagaaagctgtgaaggttcacggcctcttgaagacctttgtgaagcagacagatcatataaaagggatacgtcagattaccagtgacgatttttgtacatttcaaatggtgctagagggaggggtgtgctgcactgttacccttaactttaatgtcccaggtgagtttaagcaagatgtcattgttgtaggctcagctggccgacttattgtaacagggattgacctttatggacaaagaaacagctcctccgatcgtgaattgcttttaaaagactcaacccctgtcagcaactctcttttacctgaaaaggcatttagtgacattccatccccataccttcgaggaactattaaaatggtgcaggctgtgcgccaagcgtttcaagaccaggacgacaggagaacatgggatggtaggccgctgaccatggctgccacatttgatgactgtctttatgctttgtgcgtagttgacaccattaagaaatctaaccagactggtgaatggcaaaatattgtgattatgactgaagaacctgaattgagtcctgcatatttaattagtgaagcaatgcgcagaagcagaatgtctttgtattgttagcttagaaatcactcaaacttagaatatcaattatgagactcttaaaacaaagttgcgccagggtgaatgatgcagctttatcacacaatgcatttatcttgcattcattgctgtttccagaaaaaaagcaaatccttctctgtccatatcagaaactgtgaacttgtatgagaatgtattttatggtttggttggttctaagaaaagaaaaaagatgttattttgcctcatgtatttaataacaaacgggttatcactgaagatgtctacatttctatggaggatgcttgtataggaactttgcatattgtgaatgttacatccactggattgtattatgaaatctgtactgaatatgtagctgagatgttgtagtgttgggcttcagtatcctacccagaaactcatttctaaaggaaatatttcattctaaaggggaaaccagggatcttaatgcccaatatgcttaggtggtgtccattctgcgcacacacatcctgcgcttataaactctgccatacgcacgataaatacaagtaacaaagtttagactcagagccatggaattatgttttgtgacatggagaatgcattaaagtgacagaatttccaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaa
Translation: MLPGVGVFGTSLTSRVIIPLLKDEGFSVKALWGRTQEEAEELAKEMSVPFYTNRIDDVLLHQDVDLVCINLPPPLTKQIAVKTLGIGKNVICDRTATPLDAFRMMSAAHYYPKLMSIMGNVLRFLPAFVKMKQLIQEGYVGELQVCEVQVHSGSLLGKKYNWSCDDLMGGGGLHSVGSYIIDLLTFLTSQKAVKVHGLLKTFVKQTDHIKGIRQITSDDFCTFQMVLEGGVCCTVTLNFNVPGEFKQDVIVVGSAGRLIVTGIDLYGQRNSSSDRELLLKDSTPVSNSLLPEKAFSDIPSPYLRGTIKMVQAVRQAFQDQDDRRTWDGRPLTMAATFDDCLYALCVVDTIKKSNQTGEWQNIVIMTEEPELSPAYLISEAMRRSRMSLYC
Donor tissue: neurula