ORFeome > gjb1 – XORFeome 2.0

gjb1 – XORFeome 2.0

General Information

Species: Xenopus tropicalis gap junction protein, beta 1, 32kDa, mRNA (cDNA clone MGC:69391 IMAGE:5335319), complete cds
Gene Symbol: gjb1
Gene ID: 407921
ORF gb_acc: MG133259
ORF ID: 10742

ORF full-length analysis tests

Clone type: Putative Full Length
XGC accession: BC067915

Library Location

Plate ID: GDExt11007
Well Location: C07

EST Sequences

Clone: MGC:69391 IMAGE:5335319
Trimmed Sequence: ATGAATTGGGCAGGATTATATGCCATCCTGAGTGGCGTAAACCGCCACTCTACTTCAATTGGACGCATATGGCTCTCAGTGGTCTTCATCTTTCGCATCATGGTCCTCGTGGTGGCTGCAGAAAGTGTATGGGGGGATGAGAAGTCTGCGTTTACGTGCAACACACAACAGCCTGGTTGCAACAGTGTATGCTATGATCACTTCTTCCCCATCTCCCATATCCGTCTGTGGGCCCTTCAGCTCATTATTGTGTCCACCCCTGCCCTTCTTGTGGCCATGCATGTGGCTCACCTACAGCACCAAGAGAAGAAGGAACTACGTATGACCGGCCATGTGAAGGACCAGGAGCTGGCAGAAGTGAAGAAACACAAAGTCAAGATCTCCGGCACCTTGTGGTGGACCTACATCATTAGTGTTTTCTTCAGAATCATATTTGAGGCAGCATTTATGTACCTCTTCTACCTCATCTACCCCGGTTACTCCATGATCCGTCTTGTTAAGTGCGATGCCTATCCCTGCCCCAACACTGTTGATTGTTTTGTTTCTCGTCCCACGGAGAAGACCATATTCACAGTCTTTATGCTCGTTGCCTCTGGATTCTGCATCTTTCTGAATGTTGCTGAGATAGTCTTCCTCATTGCCCAGGCCTGCTCCCGCAAAGTCCATCGCAGACATTCTGACAGCATCAGCAAGGAGCATCAACAGAATGAAATGAACTTACTGATAACGGGAGGTAGTCTCATGAAACGGTCCCCTGGGGGGCAGGAGAAAGGAGATCACTGTTCTACTTCCTAG
Full Trace Sequence: aagcagatcccagctgagatttagtgcctgggtgcatgcccagtgactatcctgtgcctgctttccattcctactacatattttgtggaacacaactgagcagtacagcaaaacacaatgaattgggcaggattatatgccatcctgagtggcgtaaaccgccactctacttcaattggacgcatatggctctcagtggtcttcatctttcgcatcatggtcctcgtggtggctgcagaaagtgtatggggggatgagaagtctgcgtttacgtgcaacacacaacagcctggttgcaacagtgtatgctatgatcacttcttccccatctcccatatccgtctgtgggcccttcagctcattattgtgtccacccctgcccttcttgtggccatgcatgtggctcacctacagcaccaagagaagaaggaactacgtatgaccggccatgtgaaggaccaggagctggcagaagtgaagaaacacaaagtcaagatctccggcaccttgtggtggacctacatcattagtgttttcttcagaatcatatttgaggcagcatttatgtacctcttctacctcatctaccccggttactccatgatccgtcttgttaagtgcgatgcctatccctgccccaacactgttgattgttttgtttctcgtcccacggagaagaccatattcacagtctttatgctcgttgcctctggattctgcatctttctgaatgttgctgagatagtcttcctcattgcccaggcctgctcccgcaaagtccatcgcagacattctgacagcatcagcaaggagcatcaacagaatgaaatgaacttactgataacgggaggtagtctcatgaaacggtcccctggggggcaggagaaaggagatcactgttctacttcctagaggatataacgctcatggctgcctgataggacatgatggagagggcagccctgggatcatacagctgcaaaagcaaagatgagattttggggttagttacaagacttgaacaggagcagagtaaacaaaacgtggcaagaaaaggaaggaaaaaagaaaaaattatttaagattgcaatatttgcacaagaagagtgactttgccattacagctgtgttactgttggcaggtgcccgagacaaagtgtctgttttggcacagtcactccctcgattgccaagtgtttgttaatgtgccagtctgcaccggcacctcttgtagtattctttgttaagggtggggtggggtgggaaggcatgtattagagaagggtttctactgccataaactgatgttaatgttttaatatttgcaatttattttaaataaaacttgatttttaaggcaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaacaaaaaaaaaaaaaaaaaaaaaaaaaaaa
Translation: MNWAGLYAILSGVNRHSTSIGRIWLSVVFIFRIMVLVVAAESVWGDEKSAFTCNTQQPGCNSVCYDHFFPISHIRLWALQLIIVSTPALLVAMHVAHLQHQEKKELRMTGHVKDQELAEVKKHKVKISGTLWWTYIISVFFRIIFEAAFMYLFYLIYPGYSMIRLVKCDAYPCPNTVDCFVSRPTEKTIFTVFMLVASGFCIFLNVAEIVFLIAQACSRKVHRRHSDSISKEHQQNEMNLLITGGSLMKRSPGGQEKGDHCSTS
Donor tissue: tailbud