ORFeome > got1 – XORFeome 2.0

got1 – XORFeome 2.0

General Information

Species: Xenopus tropicalis glutamic-oxaloacetic transaminase 1, soluble (aspartate aminotransferase 1), mRNA (cDNA clone MGC:76052 IMAGE:5307244), complete cds
Gene Symbol: got1
Gene ID: 407943
ORF gb_acc: MG133456
ORF ID: 10977

ORF full-length analysis tests

Clone type: Putative Full Length
XGC accession: BC067312

Library Location

Plate ID: GDExt11010
Well Location: B01

EST Sequences

Clone: MGC:76052 IMAGE:5307244
Trimmed Sequence: ATGGCTTCCATTTTTACCTCCGTTCCTCAGGCTCCCCCTGTGGCTGTCTTCAAGCTTACTGCAGATTTCCGCGCTGACCCTGACACTAGGAAGGTCAACCTTGGAGTGGGAGCATATCGTACTGATGACTCTCAGCCATGGGTCCTGCCAGTGGTGAAAAAGGTGGAGCAGATGATTGCAAAAGACAGCTCTTTGAACCATGAATATCTGCCAATTTTGGGGCTGCCTGAATTCCGTTCTAGTGCTTCCAGAATTGCTTTGGGGGATGACAGCCCTGCATTTAAGGAGAATCGGGTAGGCGGTGTGCAATCCTTGGGTGGAACTGGAGCTCTGCGCATTGGAGCAGAATTTCTGAGGCGCTGGTACAATGGAAACAACAACACAGCTACTCCCATCTATATTTCTTCTCCCTCATGGGAAAACCACAATGCTGTGTTCAGTGACGCTGGATTTAAGGATATCAGGGCTTATAGTTACTGGGATGCTGCTAAAAGGGGCCTTGATCTCGAGGGATTCCTGCGGGATTTAGAGAATGCCCCCGAGTTCTCTATCTTTGTGTTGCACGCATGTGCGCACAATCCCACTGGTACAGACCCCACCCCTGATGAGTGGAAACAGATAGCTGATGTCATGAAGCGGAGGTCTCTCTTTCCTTTCTTCGACTCAGCCTATCAAGGATTTGCCTCTGGCAGCCTAGACAAGGATGCATGGGCCGTGCGTTTCTTTGTGTCTCAGGGTTTTGAGTTGTTCTGTGCTCAGTCTTTTTCCAAGAACTTTGGCTTGTACAATGAGAGAGTAGGAAACCTAACTGTTGTAGGGAAAGACTGTGATAACGTTGCACGTGTCCTGTCTCAGATGGAGAAAATTGTCCGTACAACCTGGTCAAATCCTCCATCGCAAGGAGCTCGTATTGTTGCCACCACTCTCAACACTCCTGAACTATTTGATGAATGGAGAGATAATGTAAAGACTATGGCAGAGAGAGTCCTGCTGATGAGAGCAGAACTGAAATCCCGACTGGAGGCTCTTAAAACTCCTGGGACATGGAACCATATTGTCAACCAGATAGGAATGTTCAGCTACACAGGACTTAACCCTAAGCAAGTGGAGTATCTTATTAAAGAGAAGCACATCTACTTGATGGCCAGTGGACGTATAAATATGTGTGGGCTGACAACAAAGAACCTCGACTATGTAGCCCAGTCTATTTATGAAGCAGCAACCAAGATCCAGTAA
Full Trace Sequence: gttctgtgccaggtagttgctgcttagtgatggcttccatttttacctccgttcctcaggctccccctgtggctgtcttcaagcttactgcagatttccgcgctgaccctgacactaggaaggtcaaccttggagtgggagcatatcgtactgatgactctcagccatgggtcctgccagtggtgaaaaaggtggagcagatgattgcaaaagacagctctttgaaccatgaatatctgccaattttggggctgcctgaattccgttctagtgcttccagaattgctttgggggatgacagccctgcatttaaggagaatcgggtaggcggtgtgcaatccttgggtggaactggagctctgcgcattggagcagaatttctgaggcgctggtacaatggaaacaacaacacagctactcccatctatatttcttctccctcatgggaaaaccacaatgctgtgttcagtgacgctggatttaaggatatcagggcttatagttactgggatgctgctaaaaggggccttgatctcgagggattcctgcgggatttagagaatgcccccgagttctctatctttgtgttgcacgcatgtgcgcacaatcccactggtacagaccccacccctgatgagtggaaacagatagctgatgtcatgaagcggaggtctctctttcctttcttcgactcagcctatcaaggatttgcctctggcagcctagacaaggatgcatgggccgtgcgtttctttgtgtctcagggttttgagttgttctgtgctcagtctttttccaagaactttggcttgtacaatgagagagtaggaaacctaactgttgtagggaaagactgtgataacgttgcacgtgtcctgtctcagatggagaaaattgtccgtacaacctggtcaaatcctccatcgcaaggagctcgtattgttgccaccactctcaacactcctgaactatttgatgaatggagagataatgtaaagactatggcagagagagtcctgctgatgagagcagaactgaaatcccgactggaggctcttaaaactcctgggacatggaaccatattgtcaaccagataggaatgttcagctacacaggacttaaccctaagcaagtggagtatcttattaaagagaagcacatctacttgatggccagtggacgtataaatatgtgtgggctgacaacaaagaacctcgactatgtagcccagtctatttatgaagcagcaaccaagatccagtaaagaaaccccaagctttcagtagatgaaatagcagtgtaattatgtgttgttgtagtgcgtgtccccaagctcacagtcacaaagatatctgatcacctcattatctatggctttaacaggaaccaatgaagctgctgggagatgtgttacaagtgctagcatgtttgttccgtgggacaccatgctatatattgtgattctttgggcttttacactattttgcactcaagttgttttgttttttttaaatgtttcctaatgactgcattgacatcttaattctacgtattatttgttctgcatcatcttgtaaccctgtaatttatagaaaattagatataaccttcaaaaaccttcaaccataacaaattatgttttcgttgtcatagaaatcctgcatcaaggtgtccttggcagcaagctttaatgaattttgttatgctctagatatgcatggtatcacaactaaagtctatttggttgcaatagttaactatgcaaagagccccttctgcaggaatgatacgtagaaatatccagaaactgtatatagaacattggctagaacattaactctacatgtctgagcccattctcagatggtgcaatacagatcttagaactaaggtctccaaaatctagtcatcattgctagagtgcacaatggaaaaccaaaactattgtcttaaattgaacatgctaaagcggttaatttaatgtaataaacacattctgttgagtgcaaaaaaaaaaaaaaaaaaaaaaaa
Translation: MASIFTSVPQAPPVAVFKLTADFRADPDTRKVNLGVGAYRTDDSQPWVLPVVKKVEQMIAKDSSLNHEYLPILGLPEFRSSASRIALGDDSPAFKENRVGGVQSLGGTGALRIGAEFLRRWYNGNNNTATPIYISSPSWENHNAVFSDAGFKDIRAYSYWDAAKRGLDLEGFLRDLENAPEFSIFVLHACAHNPTGTDPTPDEWKQIADVMKRRSLFPFFDSAYQGFASGSLDKDAWAVRFFVSQGFELFCAQSFSKNFGLYNERVGNLTVVGKDCDNVARVLSQMEKIVRTTWSNPPSQGARIVATTLNTPELFDEWRDNVKTMAERVLLMRAELKSRLEALKTPGTWNHIVNQIGMFSYTGLNPKQVEYLIKEKHIYLMASGRINMCGLTTKNLDYVAQSIYEAATKIQ
Donor tissue: gastrula