ORFeome > h1f0 – XORFeome 2.0

h1f0 – XORFeome 2.0

General Information

Species: Xenopus tropicalis H1 histone family, member 0, mRNA (cDNA clone MGC:69214 IMAGE:5307589), complete cds
Gene Symbol: h1f0
Gene ID: 407939
ORF gb_acc: MG133246
ORF ID: 10726

ORF full-length analysis tests

Clone type: Putative Full Length
XGC accession: BC067985

Library Location

Plate ID: GDExt11007
Well Location: D04

EST Sequences

Clone: MGC:69214 IMAGE:5307589
Trimmed Sequence: ATGACAGAGAATTCAGCTGCTGCTCCAGCTGGCAAGCCCAAGCGATCAAAGGCATCAAAGAAAGCAACTGACCACCCTAAGTATTCTGACATGATATTGGCTGCAGTGCAAGCAGAGAAGAGTCGTTCTGGTTCATCGCGTCAGTCAATCCAGAAGTACATCAAAAACCACTATAAAGTTGGAGAGAATGCAGACTCGCAAATCAAACTGTCTATTAAGAGACTGGTGACTTCTGGCACCCTCAAACAGACCAAAGGAGTGGGTGCCTCTGGATCTTTCCGGCTAGCCAAGGCAGATGAGGGCAAGAAGCCAGCCAAGAAGCCTAAAAAGGAAATTAAAAAAGCAGCTTCACCCAAAAAAGCTGCTAAGCCCAAAAAAGCTGCAAAGTCTCCTGCCAAGGCCAAGAAACCTAAAGTGGCAGAGAAGAAAGTAAAGAAACCAGCTAAGAAAAAGCCTGCACCTTCTCCTAAAAAAGCCAAAAAGACAAAAACTGTCAAAGCCAAGCCAGTGAGGGCATCCAGAGTAAAGAAGGCCAAGCCCTCCAAACCAAAGGCAAAAGCCAGCCCAAAGAAATCTGGACGGAAGAAGTAA
Full Trace Sequence: tgaggagagcgagtgcggctggcaccgagctacaatagctccgcacagctaacagggcgcacaagggacgggatccttcactgaagggaagcttacagagaagccattgccagggcttgacatttatactacaacatatgcgcaactgacaagaaaacaggtgcaaactcataatacctggggcagaaaaaaacaattaaacaataaagaatttggagaacttcagtgggaggagagactggatttggaaaggtcactacagtttatttccgagaactttgttccagggctcttattggccattggattctagcctgagtatcaagcatctcttgcaccttggctacaggttgcccaggaaagacttatcttggcaaatacctcctgctgcaccactagtttcattcttaagcctacacctgtagtgaaggttaaacatgacagagaattcagctgctgctccagctggcaagcccaagcgatcaaaggcatcaaagaaagcaactgaccaccctaagtattctgacatgatattggctgcagtgcaagcagagaagagtcgttctggttcatcgcgtcagtcaatccagaagtacatcaaaaaccactataaagttggagagaatgcagactcgcaaatcaaactgtctattaagagactggtgacttctggcaccctcaaacagaccaaaggagtgggtgcctctggatctttccggctagccaaggcagatgagggcaagaagccagccaagaagcctaaaaaggaaattaaaaaagcagcttcacccaaaaaagctgctaagcccaaaaaagctgcaaagtctcctgccaaggccaagaaacctaaagtggcagagaagaaagtaaagaaaccagctaagaaaaagcctgcaccttctcctaaaaaagccaaaaagacaaaaactgtcaaagccaagccagtgagggcatccagagtaaagaaggccaagccctccaaaccaaaggcaaaagccagcccaaagaaatctggacggaagaagtaaagctcctgcagtctctggacagctcctaacaacttgtgtacatagttttataaccttcactttttccagtgcaactttataatgatgatcagcttccctgcaattcccaagacaaatttgtgtatttgactttgcctgcactaggggaattaagcaagatttaactgcttcatttttttttattattttggtgttaaaatgtaggaatttttttcccaaggaagaagttatcaaactgggcttaacattttcaatgattttgtgtttcctagccattttaggacaagctttaacgatatcattgcacagagcttggcttaattattattaatctacctgttcttaaatgggaataatgatatctttaaatattgttcggtgtgattgtgctacattattgtcagaaatcagacgatcttgaccctaaaatgttgcttataacttaatatttaaatggtagtttaaatatgattcatagtacaattagtttggttattgtctactgatatttttgtagtttttttatttgtaggaatgagtcagcagtagactagagcacttttttgctggacaggcaatggatcacccccctgtaagtttgaactcttcatatattcacacgagatccattttttttttttttttaaacatacaaacgtttgttcaggaatgatttactaactgtacttatgcagcagcaagtgcaatgcctagaagattttgataccttttcagcaacattttaaatgttctctctatggagaaatgattagctattaagatatacaaatatcttatatattaccaactgaagactgtatttgtacttgtcaaccaagctttgagggtattaggcgtcgttcacgtactgtgaatggtgcagctaatccttttcagtatcatttgtgctgaaaatggtcagtaagcagtgaaccataacatttatttctgtatcggtgagaactaatcgagcaagtgacaagtggccatgaaatacaaatagaaatattttattcatgtgttttgctttgtagattaggattaatcctttgtaatcatgactttgaaaataaaattgccaaaacgtgaaaaaaaaaaaaaaaaa
Translation: MTENSAAAPAGKPKRSKASKKATDHPKYSDMILAAVQAEKSRSGSSRQSIQKYIKNHYKVGENADSQIKLSIKRLVTSGTLKQTKGVGASGSFRLAKADEGKKPAKKPKKEIKKAASPKKAAKPKKAAKSPAKAKKPKVAEKKVKKPAKKKPAPSPKKAKKTKTVKAKPVRASRVKKAKPSKPKAKASPKKSGRKK
Donor tissue: gastrula