ORFeome > hba-l1 – XORFeome 2.0

hba-l1 – XORFeome 2.0

General Information

Species: Xenopus tropicalis alpha globin larval-1, mRNA (cDNA clone MGC:89772 IMAGE:7027666), complete cds
Gene Symbol: hba-l1
Gene ID: 448669
ORF gb_acc: MG133181
ORF ID: 10639

ORF full-length analysis tests

Clone type: Putative Full Length
XGC accession: BC077020

Library Location

Plate ID: GDExt11006
Well Location: H03

EST Sequences

Clone: MGC:89772 IMAGE:7027666
Trimmed Sequence: ATGCTTTTCTCTGATGCCGAGAAGGCTGCAGTTGTGTCCCTCTGGGCAAAAGCATCTGGCAATGTGAATGCCCTTGGAGCTGAAGCTTTGGAAAGGCTATTTCTGAGCTACCCTCAGACCAAGACATACTTCAGCCACTTTGACTTGGGTTCTGGATCTCATGATCTTCAAGTTCATGGAGGAAAGGTCCTTGGTGCCATTGGAGAGGCCACCAAACATTTGGACAACCTGGATGAAGCTCTGTCCAAGCTGAGTGACCTGCATGCTTATAACCTGAGAGTAGATCCAGGAAATTTTAGGTTGCTGTCTCACACTATCCAAGTTACTCTGGCTGCCCACTTCCAGGCTGACTTTGATGCAACAGCCCAGGCTGCTTGGGACAAGTTCCTTGCCGCCATCTCTACTGTTCTTACCTCCAAGTACAGATAA
Full Trace Sequence: tcaagcatttttttaggttttcatctgaaaccaataatcaaaacacaagcaagatgcttttctctgatgccgagaaggctgcagttgtgtccctctgggcaaaagcatctggcaatgtgaatgcccttggagctgaagctttggaaaggctatttctgagctaccctcagaccaagacatacttcagccactttgacttgggttctggatctcatgatcttcaagttcatggaggaaaggtccttggtgccattggagaggccaccaaacatttggacaacctggatgaagctctgtccaagctgagtgacctgcatgcttataacctgagagtagatccaggaaattttaggttgctgtctcacactatccaagttactctggctgcccacttccaggctgactttgatgcaacagcccaggctgcttgggacaagttccttgccgccatctctactgttcttacctccaagtacagataaattcagactggtccctgcaaatgcagcaaaaatgaaacgccactaacagattaataaagtttataaaatacatttaaaaaaaaaaaaaaaa
Translation: MLFSDAEKAAVVSLWAKASGNVNALGAEALERLFLSYPQTKTYFSHFDLGSGSHDLQVHGGKVLGAIGEATKHLDNLDEALSKLSDLHAYNLRVDPGNFRLLSHTIQVTLAAHFQADFDATAQAAWDKFLAAISTVLTSKYR
Donor tissue: