ORFeome > hes4 – XORFeome 2.0

hes4 – XORFeome 2.0

General Information

Species: Xenopus tropicalis hairy and enhancer of split 4, mRNA (cDNA clone MGC:75875 IMAGE:5383046), complete cds
Gene Symbol: hes4
Gene ID: 394465
ORF gb_acc:
ORF ID: 10427

ORF full-length analysis tests

Clone type: Putative Full Length
XGC accession: BC059761

Library Location

Plate ID: GDExt11005
Well Location: E01

EST Sequences

Clone: MGC:75875 IMAGE:5383046
Trimmed Sequence: ATGCCTGCCGACAGCATGGAGAAGCCTACCGCATCCCCAATTGCAGGGGCACCGGCGAGCTCAGCACAGACTCCGGATAAACCCAAGAGTGCCAGTGAGCATAGAAAGTCATCCAAACCCATCATGGAGAAGCGCAGGAGAGCGCGGATCAATGAGAGCCTGGGCCAGCTAAAGACCCTCATTCTGGATGCGCTGAAAAAAGATAGCTCCAGACATTCTAAACTGGAAAAGGCCGATATCCTGGAAATGACAGTCAAGCACCTTCGGAACCTGCAGCGAGTGCAAATGACAGCCGCTCTTACAGCCGATCCCTCAGTACTAGGGAAGTACAGAGCCGGATTTAACGAGTGCATGAACGAAGTCACCCGATTCCTCTCCACCTGTGAGGGCGTCAATACTGAAGTGAGGACCAGGCTTCTCGGTCACCTCTCAAGCTGCCTGGGACAGATAGTAGCCATGAATTACCAGCAACCCCCCTCCAGCCAGCAACCACTGCACGTACAGCTTCCTTCCAGCACCCCTGCCCCTGTGCCCATGCCTTGCAAGGTGAACCCAGCAGAGGCCATCTCTCCCAAAGTATTCCAGGGAGGATTCCAGCTGGTGCCAGCCACCGACGGGCAGTTTGCTTTCCTTATTCCCAACCCAGCTTATACCACCAGCCCCGGACCTGTTATCCCTCTATATGCCAACACCAACGTGACATCGCCTGGCGGTCCCCAGAGTCAATCTCCAGTGCAGGGACTCACCACCTTCGGCCACAAGATGCCTCACATGGCACAAGCTGTCAGTCCCCTAGGGGGCAGCACCGGGGCGGACAGCGCTGAGTCCGTGTGGAGACCATGGTGA
Full Trace Sequence: gctgttagcagcacatccgcagcactaccccctattaggatacaacatcccctcctgactgcaccagtgcccgggaactgaacatgcctgccgacagcatggagaagcctaccgcatccccaattgcaggggcaccggcgagctcagcacagactccggataaacccaagagtgccagtgagcatagaaagtcatccaaacccatcatggagaagcgcaggagagcgcggatcaatgagagcctgggccagctaaagaccctcattctggatgcgctgaaaaaagatagctccagacattctaaactggaaaaggccgatatcctggaaatgacagtcaagcaccttcggaacctgcagcgagtgcaaatgacagccgctcttacagccgatccctcagtactagggaagtacagagccggatttaacgagtgcatgaacgaagtcacccgattcctctccacctgtgagggcgtcaatactgaagtgaggaccaggcttctcggtcacctctcaagctgcctgggacagatagtagccatgaattaccagcaacccccctccagccagcaaccactgcacgtacagcttccttccagcacccctgcccctgtgcccatgccttgcaaggtgaacccagcagaggccatctctcccaaagtattccagggaggattccagctggtgccagccaccgacgggcagtttgctttccttattcccaacccagcttataccaccagccccggacctgttatccctctatatgccaacaccaacgtgacatcgcctggcggtccccagagtcaatctccagtgcagggactcaccaccttcggccacaagatgcctcacatggcacaagctgtcagtcccctagggggcagcaccggggcggacagcgctgagtccgtgtggagaccatggtgataacgcgaacagccatcagactgtgtatatattggttccgttgtatgggaccctgccttaaagacaatctgcacaaaatgctatttatttccaaatttggggatttcacttttttattgtttaataaataaaacaaacttgtatagatgacccatttttgtaacaaagctcttttttctgagatgttttttagttttgtacaattgcgtacaaaaatgtgtatgccaaagtttattgtgttggtttttgtgtcaaaaactttccgaacatgcaggagttttattgaataaactcttttcatttgaaaaaaaaaaaaaaaaaaaa
Translation: MPADSMEKPTASPIAGAPASSAQTPDKPKSASEHRKSSKPIMEKRRRARINESLGQLKTLILDALKKDSSRHSKLEKADILEMTVKHLRNLQRVQMTAALTADPSVLGKYRAGFNECMNEVTRFLSTCEGVNTEVRTRLLGHLSSCLGQIVAMNYQQPPSSQQPLHVQLPSSTPAPVPMPCKVNPAEAISPKVFQGGFQLVPATDGQFAFLIPNPAYTTSPGPVIPLYANTNVTSPGGPQSQSPVQGLTTFGHKMPHMAQAVSPLGGSTGADSAESVWRPW
Donor tissue: neurula