ORFeome > hmgb2 – XORFeome 2.0

hmgb2 – XORFeome 2.0

General Information

Species: Xenopus tropicalis high-mobility group box 2, mRNA (cDNA clone MGC:75666 IMAGE:5379926), complete cds
Gene Symbol: hmgb2
Gene ID: 394499
ORF gb_acc: MG132828
ORF ID: 10177

ORF full-length analysis tests

Clone type: Full Length
XGC accession: BC061601

Library Location

Plate ID: GDExt11002
Well Location: D07

EST Sequences

Clone: MGC:75666 IMAGE:5379926
Trimmed Sequence: ATGGGCAAGGGAGATCCTAACAAGCCAAGGGGCAAGATGTCGTCCTATGCGTACTTTGTGCAGACGTGCAGAGAAGAACACAAGAAGAAACACCCGGACTCCTCTGTTAACTTCGCCGAGTTCTCAAAGAAGTGCTCCGAGAGGTGGAAGACCATGTCTGCAAAAGAGAAATCAAAGTTTGAAGAGATGGCAAAAAATGATAAAGTCAGATATGAACGTGAGATGAAAACCTATATACCACCTAAAGGAGAGAAGAAGGGAAAGAAAAAGAAGGATCCAAACGCACCAAAGAGGCCACCATCTGCCTTTTTCCTATTCTGTTCTGAACATCGTCCCCAGATAAAGAGTGAGAGTCCTGGTCTTTCCATTGGTGACACTGCTAAGAAGCTAGGAGAAATGTGGTCAGAGCAGACTCCTAAGGATAAGCTACCATATGAGCAAAAAGCAGCCAAGCTAAAGGAGAAATATGAGAAAGATGTTGCTGCATACAAGGCAAAGGGGAAAAGTGATGTTGGCAAGAAAGTTCCAGGAAGGCCGACAGGTTCTAAAAAGAAGGCTGAACCAGAGGAAGACGATGATGATGAAGATGAGGACGAAGAGGATGAGGAGGATGATGATGATGAGGATGATGATGAATAA
Full Trace Sequence: cacacagagcggtcggcagttatctttggattgtgtcttttcattcaggcatcatgggcaagggagatcctaacaagccaaggggcaagatgtcgtcctatgcgtactttgtgcagacgtgcagagaagaacacaagaagaaacacccggactcctctgttaacttcgccgagttctcaaagaagtgctccgagaggtggaagaccatgtctgcaaaagagaaatcaaagtttgaagagatggcaaaaaatgataaagtcagatatgaacgtgagatgaaaacctatataccacctaaaggagagaagaagggaaagaaaaagaaggatccaaacgcaccaaagaggccaccatctgcctttttcctattctgttctgaacatcgtccccagataaagagtgagagtcctggtctttccattggtgacactgctaagaagctaggagaaatgtggtcagagcagactcctaaggataagctaccatatgagcaaaaagcagccaagctaaaggagaaatatgagaaagatgttgctgcatacaaggcaaaggggaaaagtgatgttggcaagaaagttccaggaaggccgacaggttctaaaaagaaggctgaaccagaggaagacgatgatgatgaagatgaggacgaagaggatgaggaggatgatgatgatgaggatgatgatgaataaatgctttgtctgctgtataaattgtgctgaagcccattgtttttgctaagaatgtgaactcgagtgcagctcattttgttagcttggttatacaaaactgtacagaattgtgtataggtaatgtgattgttagggaaaacctatattttaatataagtagtggacgggctgttagtgtaagagcttctgatgtgggattattctgcatatttaatgaatccaatggtagcaaagtgtgttagtaacaagacccatttattctttagaccttatagacctggtgcattgtacttttctaactttttttagctgtttttgtaataaaatttatatatcccaaaaaaaaaaaaaaaaaaaaaaaa
Translation: MGKGDPNKPRGKMSSYAYFVQTCREEHKKKHPDSSVNFAEFSKKCSERWKTMSAKEKSKFEEMAKNDKVRYEREMKTYIPPKGEKKGKKKKDPNAPKRPPSAFFLFCSEHRPQIKSESPGLSIGDTAKKLGEMWSEQTPKDKLPYEQKAAKLKEKYEKDVAAYKAKGKSDVGKKVPGRPTGSKKKAEPEEDDDDEDEDEEDEEDDDDEDDDE
Donor tissue: tadpole