ORFeome > hoxa1 – XORFeome 2.0

hoxa1 – XORFeome 2.0

General Information

Species: Xenopus tropicalis homeobox A1, mRNA (cDNA clone MGC:79507 IMAGE:6977173), complete cds
Gene Symbol: hoxa1
Gene ID: 493379
ORF gb_acc: MG133581
ORF ID: 11117

ORF full-length analysis tests

Clone type: Putative Full Length
XGC accession: BC080895

Library Location

Plate ID: GDExt11010
Well Location: C09

EST Sequences

Clone: MGC:79507 IMAGE:6977173
Trimmed Sequence: ATGGACTATGCGAGGATGAGCTCCTTCCTAGAGTACCCGGGCTTAATGAGCGGCGACCTCGGGACCTGCTCCTCCAGATCCTTCCACCCCGACCATGGAATTACAACTTTCCAGTCGTGCGCAGTCAGTGCTAATAACTGCAACAGCGATGATCGTTTTGTGGTCGGACGAGGGGTGCAGATAAGTTCTCACCCCCATCACCACCACCACCAAGCCGGTGCCTTTCAGCACCACAACAACCTGGGGATGTCTTATACTCATACCAGCTGTGGCTCCAACTATGGCATGCAGAACTTCAGCCCCGGCTACTCTCATTTCCCCATCAATCAAGAGGCAGATGTGAGCGCAGGGTTCCCCCAATCTGTCTACTCCGGCAACATCGCTTCGTCTGTGGTCCAGCATCACCAACACCAGTCTTACATCGAAGGATCCGCTCACTATATCCACCATTCCTACGGACCTGACCAGAACATTTCTGTGGCCAATTACAATAACAATGTATCCAGCCTACATATCAGCCAGAGAGAAGTTTGCCGGTCTCCTTCCAGCGAAACATCCCCGGGCCCTGCACAGACCTTTGACTGGATGAAAGTAAAGAGAAACCCACCCAAAACAGGTAAAGCTGGGGAATATGGCTTTGCCGGCCAGCCCAACACAGCCAGGACCAACTTCACCACCAAACAGCTGACAGAACTAGAGAAAGAATTTCATTTCAACAAGTACTTGACCAGGGCCCGCAGGGTAGAAATTGCTGCTGCTCTACAGCTCAATGAGACCCAAGTAAAAATCTGGTTCCAGAACAGGAGGATGAAACAGAAAAAAAGGGAAAAAGAAGGACTTCTCCCCATCTCCCCATCAGCCAGTACAGGAAGCGATGAAAAGTCAGAGGAGCTGTCAGAAAAGTCCAATTCTTCACCCTGTGCTCCATCTCCTGCCTCCTCTACTTCAGATCATCTCAGTACTTCCGGTTAG
Full Trace Sequence: cacggccacgccaggctctgtgtcacagtcacctagtgatagatggactatgcgaggatgagctccttcctagagtacccgggcttaatgagcggcgacctcgggacctgctcctccagatccttccaccccgaccatggaattacaactttccagtcgtgcgcagtcagtgctaataactgcaacagcgatgatcgttttgtggtcggacgaggggtgcagataagttctcacccccatcaccaccaccaccaagccggtgcctttcagcaccacaacaacctggggatgtcttatactcataccagctgtggctccaactatggcatgcagaacttcagccccggctactctcatttccccatcaatcaagaggcagatgtgagcgcagggttcccccaatctgtctactccggcaacatcgcttcgtctgtggtccagcatcaccaacaccagtcttacatcgaaggatccgctcactatatccaccattcctacggacctgaccagaacatttctgtggccaattacaataacaatgtatccagcctacatatcagccagagagaagtttgccggtctccttccagcgaaacatccccgggccctgcacagacctttgactggatgaaagtaaagagaaacccacccaaaacaggtaaagctggggaatatggctttgccggccagcccaacacagccaggaccaacttcaccaccaaacagctgacagaactagagaaagaatttcatttcaacaagtacttgaccagggcccgcagggtagaaattgctgctgctctacagctcaatgagacccaagtaaaaatctggttccagaacaggaggatgaaacagaaaaaaagggaaaaagaaggacttctccccatctccccatcagccagtacaggaagcgatgaaaagtcagaggagctgtcagaaaagtccaattcttcaccctgtgctccatctcctgcctcctctacttcagatcatctcagtacttccggttagaaggctgaaggcattgcctgtgctcgattgatcaaccaaagccttagcagtgattttagttgtctattgtttatgccagaatttcagctggtaccattaagattatatttttgcacaagtttgaaaagtcattttcgttttgagctaaaatacccaagttaactaaaacctgttttggcatgtgtcacactaactgtctcttgctatgagctgctatggacaatccatatgagggacattcctgctgggactttttactgggaaatcactggttgcagatcctcaaggactgatgcactactaatagagaaaaagtttacacaagttaaaagacttctatttaatttaaagttctatggtgtctgtatgtgaaaagagtgtacatatattgttccagagatttatctttcaagtgtttttgtagaaattctaataattatcagatggtggagtggttggaagaatctcaaagttttctagcacaggaaaagacagcagtgtttgctgaccgcatacctcagtaatctctcacatttactaggtgtttacagtcatgattttaggtgaatattgtgtgttttgtttgtcaggaaatcgtgctagatcgtccagtatccagggtatttatccaaacaaaaccactcgttctctgatccaagagaaacgcttctaaatcgcctttaagtgaatgtcttgtaagaccaaatgtgtgtataatttgtgattccatcgcgaacccttgcatgacaccgaatgtaaactgagttttatcagttggaatttgtcaataaaacatttgtatgctaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaa
Translation: MDYARMSSFLEYPGLMSGDLGTCSSRSFHPDHGITTFQSCAVSANNCNSDDRFVVGRGVQISSHPHHHHHQAGAFQHHNNLGMSYTHTSCGSNYGMQNFSPGYSHFPINQEADVSAGFPQSVYSGNIASSVVQHHQHQSYIEGSAHYIHHSYGPDQNISVANYNNNVSSLHISQREVCRSPSSETSPGPAQTFDWMKVKRNPPKTGKAGEYGFAGQPNTARTNFTTKQLTELEKEFHFNKYLTRARRVEIAAALQLNETQVKIWFQNRRMKQKKREKEGLLPISPSASTGSDEKSEELSEKSNSSPCAPSPASSTSDHLSTSG
Donor tissue: tailbud