ORFeome > hspe1 – XORFeome 2.0

hspe1 – XORFeome 2.0

General Information

Species: Xenopus tropicalis heat shock 10kDa protein 1 (chaperonin 10), mRNA (cDNA clone MGC:89647 IMAGE:7025831), complete cds
Gene Symbol: hspe1
Gene ID: 448701
ORF gb_acc: MG133079
ORF ID: 10496

ORF full-length analysis tests

Clone type: Putative Full Length
XGC accession: BC077653

Library Location

Plate ID: GDExt11005
Well Location: D07

EST Sequences

Clone: MGC:89647 IMAGE:7025831
Trimmed Sequence: ATGGCAGTTCGAGCTTTCAAAAAGTTTGTTCCTCTATTTGATCGTGTCCTTGTTGAGCGGCTTGCTGCAGAAACTGTAACTAAAGGGGGAATCATGCTTCCTGAAAAATCACAAGGAAAGGTGCTGCAAGCAACTGTAGTTGCTGTTGGAGATGGTTCCAGAGGAAAGACGGGAGATATTCAGCCTGTGAGTGTAAAAGTTGGTGAGAAAATCCTTTTACCTGAATATGGAGGTACGAAGGTTGTACTGGATGACAAGGAGTACTTCTTATTCAGAGATGGAGACATTCTAGGAAAATATATAGATTAG
Full Trace Sequence: agtctgcgctaggagcttgtagagttggttgctgctttgcacatcaagtcttgcttaactatggcagttcgagctttcaaaaagtttgttcctctatttgatcgtgtccttgttgagcggcttgctgcagaaactgtaactaaagggggaatcatgcttcctgaaaaatcacaaggaaaggtgctgcaagcaactgtagttgctgttggagatggttccagaggaaagacgggagatattcagcctgtgagtgtaaaagttggtgagaaaatccttttacctgaatatggaggtacgaaggttgtactggatgacaaggagtacttcttattcagagatggagacattctaggaaaatatatagattagactgttgtttgttacttttcaagtatgttcattccaataaaaacttgctttgtgtaaataacctttttgttataataaatggtaatgtataaaaaaaaaaaaaaa
Translation: MAVRAFKKFVPLFDRVLVERLAAETVTKGGIMLPEKSQGKVLQATVVAVGDGSRGKTGDIQPVSVKVGEKILLPEYGGTKVVLDDKEYFLFRDGDILGKYID
Donor tissue: