ORFeome > id2 – XORFeome 2.0

id2 – XORFeome 2.0

General Information

Species: Xenopus tropicalis inhibitor of DNA binding 2, dominant negative helix-loop-helix protein, mRNA (cDNA clone MGC:75823 IMAGE:5382465), complete cds
Gene Symbol: id2
Gene ID: 394480
ORF gb_acc: MG133035
ORF ID: 10430

ORF full-length analysis tests

Clone type: Putative Full Length
XGC accession: BC059758

Library Location

Plate ID: GDExt11004
Well Location: D06

EST Sequences

Clone: MGC:75823 IMAGE:5382465
Trimmed Sequence: ATGAAAGCATTCAGCCCAGTAAGGTCTGTCCGAAAAAGCAGCCTAACGGAACACAGCCTGGGCATAGCTCGGAGCAAAACGCCAGTGGATGACCCGATGAGCCTCTTGTACAATATGAATGATTGTTACTCTAAGCTGAAGGAACTGGTGCCCAGTATTCCCCAGAACAAGAAGGTCAGCAAGATGGAGATCCTCCAGCACGTCATCGACTATATCCTGGACCTGCAGCTCGCCCTGGATTCCCACCCCAGCATTGTCAGTCTCCATCATGCCCGGGTGGGGGGCAGCACGTCCCGGACCCCCCTGACCGCCCTAAACACAGACATCAGCATCCTGTCACTGCAGGCGGCTGAATTATCGGCAGAGTTCACAGACGAGAGCAAATCCCTTTGTCCTTAA
Full Trace Sequence: gattaggagaggcgtacggcgttagctggttgtgctgcggttatattagagtgtgtgtgtgcgcggtgggagcgatccattcctacctaaacggtaccatgaaagcattcagcccagtaaggtctgtccgaaaaagcagcctaacggaacacagcctgggcatagctcggagcaaaacgccagtggatgacccgatgagcctcttgtacaatatgaatgattgttactctaagctgaaggaactggtgcccagtattccccagaacaagaaggtcagcaagatggagatcctccagcacgtcatcgactatatcctggacctgcagctcgccctggattcccaccccagcattgtcagtctccatcatgcccgggtggggggcagcacgtcccggacccccctgaccgccctaaacacagacatcagcatcctgtcactgcaggcggctgaattatcggcagagttcacagacgagagcaaatccctttgtccttaaaatggtgttcagcctgactgtttccctttgcacatcatggctacaagactcacttcattatctgagtgctgcatttgtacagccagctcctgggagagacgggagggagggggccacacacccaaggtggctggggaaaaagagaaaataaaaagacttatccagatttaaatatatatatatatatccccctcccttgccgcccccgcccccgatcctccaatcaagcttctcggactgctttcagttatttatgaagagacttttaataatgttataatgaccttttcttacatggggaaggattgcgctacaattatcccctacctatggggagtgatcgttttaataaaggaaaaaagaaaagcgagtgccacaaggggttttgccacttaccatccgcattcgactcttttgttggcgataaaaagggcgaattgcttcgggcacgaagaggaagattcggaaactattcagttttgctcgaaaattaaacccgaaacgtcgaaccattccaccccggactgaatgctcctttgtacatagatcccattgtttaactctttatttggagttattttgtcccacttcacccccaccccttgtacagtggcagagatggtgctatttctgcagatgtgtaatgattgaatcatgctagactttttataaaagtttggttgtaaagcctttttttatacagaataaatcgatcgtgtttatggaaaaaaaaaaaaaaaaaaaaaaaaaaaaa
Translation: MKAFSPVRSVRKSSLTEHSLGIARSKTPVDDPMSLLYNMNDCYSKLKELVPSIPQNKKVSKMEILQHVIDYILDLQLALDSHPSIVSLHHARVGGSTSRTPLTALNTDISILSLQAAELSAEFTDESKSLCP
Donor tissue: neurula