ORFeome > ilf2 – XORFeome 2.0

ilf2 – XORFeome 2.0

General Information

Species: Xenopus tropicalis interleukin enhancer binding factor 2, 45kDa, mRNA (cDNA clone MGC:75701 IMAGE:5380574), complete cds
Gene Symbol: ilf2
Gene ID: 394593
ORF gb_acc:
ORF ID: 10327

ORF full-length analysis tests

Clone type: Full Length
XGC accession: BC061266

Library Location

Plate ID: GDExt11003
Well Location: H11

EST Sequences

Clone: MGC:75701 IMAGE:5380574
Trimmed Sequence: ATGAGGGGTGAACGAGGACGTGGACGTGGCCGCTTTGGCTCCAGAGTGGGACCTAACACAGGTTTCAGACCCTTCGTCCCTCACATTCCCTTTGATTTCCACGTGTGTGAAATGGCCTTCCCGCGTGTGAAACCCGCCCCCGACGATAGCTCATTCAGCGAGTCACTGCTCAAACGAAACCAAGATCTGGCCCCCAGCACAGCCGAGCAGGCCTCAATCCTTTCTTTGGTCACCAAAATCAACAACGTTATCGACAATTTGATCGTAGCCCCGGGAAACTTTGAAGTGCAAATTGAGGAGGTGCGACAGGTGGGCTCCTACAAGAAAGGGACCATGAGCACAGGCCATAATGTTGCAGACTTGGTCGTCATCCTAAAGATCCTTCCCACACTGGAAGCCGTTTCTGCTTTGGGCATTAAGGTGGTCGAGACCCTAAGGACGCAGGATCCAGCTGAAGTTCTCACAATGCTGACAAACGAGACTGGCTTTGAGATCAGCTCAGCAGACGCCACGGTGAAGATCCTTATCACGACTGTGCCGCCCAATCTGCGCAAGCTGGACCCCGAGTTGCATTTGGACATCAAAGTTCTGCAGAGCGCGCTGGCCGCCATCAGGCACGCACGGTGGTTCGAGGAGAACGCCTCCCATTCTACAGTGAAGGTTTTAATCCGGTTGTTGAAAGACTTGAGGAGTCGGTTTCCTGGATTTGAGCCTCTGACTCCCTGGATCCTGGACCTCTTGGGGCATTATGCCGTCATGAACAACCCCACCAGGCAGCCGCTGGCACTCAATGTGTCCTACAAACGCTGCCTACAGATGCTCGCCGCCGGCCTTTTCCTCCCCGGCTCAGTTGGCATCACTGACCCCTGTGAAAGTGGCAACTTTAGGGTTCATACAGTCATGACTCTGGAGCAGCAGGACATGGTTTGCTACACTGCCCAGACGTTGGTCCGTATTCTCTCCCACGGGGGCTTCCGGAAGATATTGGGCCTGGAGGGAGATGCCAGCGCTCTTGCCACGGAAATGTCTACCTGGGACGGAGTCATCGTGACCCCTTCAGAGAAGGCCTATGAGAAGCCCCCCGAGAGGAAGGAGGGAGAGGAGGATGAGAACCAGGATATCCCAGAGGGGGCGGAAGAGGAGGAGAGCATGGAGACACAGGAGTGA
Full Trace Sequence: cgagggccgagagggtgtccattgtgcgggagtgtgaggaacgaagatctgaaacatgaggggtgaacgaggacgtggacgtggccgctttggctccagagtgggacctaacacaggtttcagacccttcgtccctcacattccctttgatttccacgtgtgtgaaatggccttcccgcgtgtgaaacccgcccccgacgatagctcattcagcgagtcactgctcaaacgaaaccaagatctggcccccagcacagccgagcaggcctcaatcctttctttggtcaccaaaatcaacaacgttatcgacaatttgatcgtagccccgggaaactttgaagtgcaaattgaggaggtgcgacaggtgggctcctacaagaaagggaccatgagcacaggccataatgttgcagacttggtcgtcatcctaaagatccttcccacactggaagccgtttctgctttgggcattaaggtggtcgagaccctaaggacgcaggatccagctgaagttctcacaatgctgacaaacgagactggctttgagatcagctcagcagacgccacggtgaagatccttatcacgactgtgccgcccaatctgcgcaagctggaccccgagttgcatttggacatcaaagttctgcagagcgcgctggccgccatcaggcacgcacggtggttcgaggagaacgcctcccattctacagtgaaggttttaatccggttgttgaaagacttgaggagtcggtttcctggatttgagcctctgactccctggatcctggacctcttggggcattatgccgtcatgaacaaccccaccaggcagccgctggcactcaatgtgtcctacaaacgctgcctacagatgctcgccgccggccttttcctccccggctcagttggcatcactgacccctgtgaaagtggcaactttagggttcatacagtcatgactctggagcagcaggacatggtttgctacactgcccagacgttggtccgtattctctcccacgggggcttccggaagatattgggcctggagggagatgccagcgctcttgccacggaaatgtctacctgggacggagtcatcgtgaccccttcagagaaggcctatgagaagccccccgagaggaaggagggagaggaggatgagaaccaggatatcccagagggggcggaagaggaggagagcatggagacacaggagtgatacttatttaaagatttcagttggtctggatccccctctgccggcgccgaacacattgggtctgtttgtggaccaaatgccacgagttcctgttttattttcattcgttcttagcttgtcatgtgacttgttttatactgtagggatacattgtatttttttttttttttgccagcaataaatttttatttcgacaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaa
Translation: MRGERGRGRGRFGSRVGPNTGFRPFVPHIPFDFHVCEMAFPRVKPAPDDSSFSESLLKRNQDLAPSTAEQASILSLVTKINNVIDNLIVAPGNFEVQIEEVRQVGSYKKGTMSTGHNVADLVVILKILPTLEAVSALGIKVVETLRTQDPAEVLTMLTNETGFEISSADATVKILITTVPPNLRKLDPELHLDIKVLQSALAAIRHARWFEENASHSTVKVLIRLLKDLRSRFPGFEPLTPWILDLLGHYAVMNNPTRQPLALNVSYKRCLQMLAAGLFLPGSVGITDPCESGNFRVHTVMTLEQQDMVCYTAQTLVRILSHGGFRKILGLEGDASALATEMSTWDGVIVTPSEKAYEKPPERKEGEEDENQDIPEGAEEEESMETQE
Donor tissue: tadpole