ORFeome > kbtbd4 – XORFeome 2.0

kbtbd4 – XORFeome 2.0

General Information

Species: Xenopus tropicalis kelch repeat and BTB (POZ) domain containing 4, mRNA (cDNA clone MGC:76129 IMAGE:5309218), complete cds
Gene Symbol: kbtbd4
Gene ID: 395033
ORF gb_acc: MG132722
ORF ID: 10018

ORF full-length analysis tests

Clone type: Full Length
XGC accession: BC064867

Library Location

Plate ID: GDExt11001
Well Location: F09

EST Sequences

Clone: MGC:76129 IMAGE:5309218
Trimmed Sequence: ATGGAACCTTCTGAGGAGGCTCAGAGCCTCACCAGCTCCAGCGATGAGAATTACTTTGTGACGTACACCTTTACCGACCGCACTCACAGCAGCCGGATGGCTCACAGCATCATACGGCTTTGCATGGAGGAGATGCTGTTTGCCGACGTCACTGTTCTTGTAGAAGGAAAGGAGTTCAAGCTCCACCGCCTGATTCTGTCTGCCCAGAGTTGCTTCTTCCGCTCCATGTTTGCCTCCAACCTGAAAGAGGGTAGGAATCAAGTCATCCAGCTCCACGATGTAAGTGAAAGCATATTCCAGCTGCTGGTGGATTACATTTATTATGGTACGGTGAAACTACGCATAGAGGAGCTGCAAGAGACGTACGAGGTGGCAGATATGTACCAGCTTACGGCTCTGTTTGAAGAATGCTCCCGCTTCCTGGTCCGGACAGTGCAGGTGAAGAACTGCCTGCAGATTATGTGGCTGGCAGATCAGCACAGCGACTCCTCACTATACACGGCGGCCAAGCACTGCGCCAAAACTCACTTGTCCCAGATACATGATTCGGAAGAGTTCCTTAACCTGCCCTTGCGGCTGCTGAGAGATATCATAGAAGATGGAGTTCCTTGTTCCCAGAATCCAACTACAGCAATCAAAAACTGGATCAACTACAACAAGCAAGAACGGGAGGAATTCTCAGACGTGCTCCTTTCTAGCCTAAAGGAAATTGGCGAGAATGTACATATCTACTTGATTGGAAAGGAGGAATCGCGTACTCATTCCATTGCAGTTTCCCTGCACTGCGCTCAGGATGATTCCATAAGTGTAAGCGGGCAAAATAGCCTGTGCCACCAGATCACTGCAGCCTGCAAGCACGGCTCCGACCTGTATGTGGTGGGCGGCTCAATCCCCCGGCGCATGTGGAAATGTAACATGGAGACCATGGACTGGGAGCGCTGTGCCCCGCTTCCCCGAGATCGCCTGCAGCATACACTTGTGTCTGTCCCCAGCAAGGATGCTATATATTCCCTAGGCGGCAAAACCCTGCAGGACTCGCTGTCTAATGTGGTCATTTATTATCGAGTGCAGGACAATGTCTGGACAGAAACAAGCCAGCTGGAGGTTGCAATCTCTGGTGCCGCCGGGGTTAACCTCAACGGGCAAATCTACCTGATGGGGGGTGAGGAGAATGACCTGGACTTCTTCACTAAACCCTCGCGCCTTATTCAGTGCTTTGATACAAATGCAGAAAAATGCCACGTGAAACCTTACCTCCTGCCCTTCGCCGGGCGAATGCACGCTGCGGTACACAAGGACCTGGTATTCATTGTGGCAGAAGGAGACTCTCTGGTCTGTTACAACCCTCTACTGGACAGCTTCACGCGACTCTGCCTCCCTGAGGCTTGGAGCGCCCGGCCTTCCTTATGGAAAATCGCCAGCTGCAACGGCTGCATCTATGTCTTCAGAGACCACTACAAAAAAGGAGACGCCAATACCTTTAAGCTCAACCCGGCAACTTCAGTGGTAACAGTCACCAGCGGCATCCGCTTCTTGCTGACCAACTTGCAGTTCCTATTGGCGTAA
Full Trace Sequence: cagggaccgaaccccagcttttgggcatcgacatacagcgctgctagaaagttctctttggagtcaagcatggaaccttctgaggaggctcagagcctcaccagctccagcgatgagaattactttgtgacgtacacctttaccgaccgcactcacagcagccggatggctcacagcatcatacggctttgcatggaggagatgctgtttgccgacgtcactgttcttgtagaaggaaaggagttcaagctccaccgcctgattctgtctgcccagagttgcttcttccgctccatgtttgcctccaacctgaaagagggtaggaatcaagtcatccagctccacgatgtaagtgaaagcatattccagctgctggtggattacatttattatggtacggtgaaactacgcatagaggagctgcaagagacgtacgaggtggcagatatgtaccagcttacggctctgtttgaagaatgctcccgcttcctggtccggacagtgcaggtgaagaactgcctgcagattatgtggctggcagatcagcacagcgactcctcactatacacggcggccaagcactgcgccaaaactcacttgtcccagatacatgattcggaagagttccttaacctgcccttgcggctgctgagagatatcatagaagatggagttccttgttcccagaatccaactacagcaatcaaaaactggatcaactacaacaagcaagaacgggaggaattctcagacgtgctcctttctagcctaaaggaaattggcgagaatgtacatatctacttgattggaaaggaggaatcgcgtactcattccattgcagtttccctgcactgcgctcaggatgattccataagtgtaagcgggcaaaatagcctgtgccaccagatcactgcagcctgcaagcacggctccgacctgtatgtggtgggcggctcaatcccccggcgcatgtggaaatgtaacatggagaccatggactgggagcgctgtgccccgcttccccgagatcgcctgcagcatacacttgtgtctgtccccagcaaggatgctatatattccctaggcggcaaaaccctgcaggactcgctgtctaatgtggtcatttattatcgagtgcaggacaatgtctggacagaaacaagccagctggaggttgcaatctctggtgccgccggggttaacctcaacgggcaaatctacctgatggggggtgaggagaatgacctggacttcttcactaaaccctcgcgccttattcagtgctttgatacaaatgcagaaaaatgccacgtgaaaccttacctcctgcccttcgccgggcgaatgcacgctgcggtacacaaggacctggtattcattgtggcagaaggagactctctggtctgttacaaccctctactggacagcttcacgcgactctgcctccctgaggcttggagcgcccggccttccttatggaaaatcgccagctgcaacggctgcatctatgtcttcagagaccactacaaaaaaggagacgccaatacctttaagctcaacccggcaacttcagtggtaacagtcaccagcggcatccgcttcttgctgaccaacttgcagttcctattggcgtaatggagaagcctgcagtgctcgccattccatagtcctataaaagggctaccccttttgtaggacatacataaaacaactgacgtccaaagaattaaagggaccaactgcattgctccaaaggatagtataatatagccagctggcagcctacatcacccctgtatttttcttacataactacatgctgctttgtatgaggttgagtattataagcagagaaaccaaaattctttcctgtatttccttttgttgtcaccatgtattgaccattttaaaagaatattggtttttaacaatccatccaagtggaatatatttgaaacagctcaacagtgggacattctgtgctaaagaacagcctggtctgaacgcattgctgttgcttttgttgtttacaacgaggtagcgcttgtgaaattctgatggcttcatttactccaaagaagggtgtctcttccatttttactcactgtcattgcttatcactgaaacagcgtctatttgccctgttactttaaaaacaaacactggaccatttctgatacctctgtgcatactgctgctttgtgttcttctatctcaggcatggtgaactcccaactacgctgattaagtggagggaactccagtaagggctgtcatagttccagtgtcattgtgtctgcagaatttgtaacaatatgactgactggctgctgattggttcatccctcttccaatcagaagctcctaggtagttagaaactctaaataaacgctgagcccaaaataacatggtaatgcctacattgaaggagactagcaaagattaaaatgggagaggggggattggcttataaataacaacgtgtaagaatgtcgcagatgaaaagaaaagatgagaatagaaaagatagaatagaaaaatggggcaggtcaaaagtgattgcgacgctttccacatctattaggcatcgctgtcaaaacattgtcctaagaacctgctaggtttgagaataaaacactgtcatactttatgtaacatgtgttattatatgatcaaaagcagagtaataaattatgaagatcccttaagataaaaataaaaaaaaaaaaaataaaaaaaaaaaaaaaaa
Translation: MEPSEEAQSLTSSSDENYFVTYTFTDRTHSSRMAHSIIRLCMEEMLFADVTVLVEGKEFKLHRLILSAQSCFFRSMFASNLKEGRNQVIQLHDVSESIFQLLVDYIYYGTVKLRIEELQETYEVADMYQLTALFEECSRFLVRTVQVKNCLQIMWLADQHSDSSLYTAAKHCAKTHLSQIHDSEEFLNLPLRLLRDIIEDGVPCSQNPTTAIKNWINYNKQEREEFSDVLLSSLKEIGENVHIYLIGKEESRTHSIAVSLHCAQDDSISVSGQNSLCHQITAACKHGSDLYVVGGSIPRRMWKCNMETMDWERCAPLPRDRLQHTLVSVPSKDAIYSLGGKTLQDSLSNVVIYYRVQDNVWTETSQLEVAISGAAGVNLNGQIYLMGGEENDLDFFTKPSRLIQCFDTNAEKCHVKPYLLPFAGRMHAAVHKDLVFIVAEGDSLVCYNPLLDSFTRLCLPEAWSARPSLWKIASCNGCIYVFRDHYKKGDANTFKLNPATSVVTVTSGIRFLLTNLQFLLA
Donor tissue: gastrula