ORFeome > ldha – XORFeome 2.0

ldha – XORFeome 2.0

General Information

Species: Xenopus tropicalis lactate dehydrogenase A, mRNA (cDNA clone MGC:76171 IMAGE:5335552), complete cds
Gene Symbol: ldha
Gene ID: 394758
ORF gb_acc: MG132697
ORF ID: 9988

ORF full-length analysis tests

Clone type: Full Length
XGC accession: BC061615

Library Location

Plate ID: GDExt11001
Well Location: G03

EST Sequences

Clone: MGC:76171 IMAGE:5335552
Trimmed Sequence: ATGGCGACCGTAAAGGATAAACTCATTCACAATCTGCTCAAGGAGGAGTCGCTCCCCCAAAACAAGGTCACCATTGTGGGTGTCGGGGCCGTTGGCATGGCCTGTGCCATCAGCGTCCTGCAGAAGGATTTGGCAGATGAGCTTGCACTCGTTGATGTGATTGAGGACAAACTAAAGGGGGAAATGATGGATCTGCAGCACGGCAGCCTCTTCCTCCGTACCCCCAAGATTGTGTCTGGGAAAGATTACAGCGTCACAGCAAACTCCAGGCTGGTGGTGGTGACGGCGGGGGCCCGGCAGCAGGAGGGGGAGAGTCGCCTCAATCTGGTTCAGCGCAACGTCAACATCTTCAAGTTCATCATTCCCAACATCGTGAAGTACAGCCCCCACTGTACCCTCCTCATCGTCTCCAACCCCGTTGACATTCTGACCTACGTGGCCTGGAAGATCAGTGGTTTCCCCAAGAATCGCGTGATTGGCAGCGGCTGCAACTTGGACTCCGCCCGGTTCCGTTACCTCATGGGGCAGAAGTTCGGGATCCACACCCAGAGCTGCCACGGTTGGGTCATTGGGGAACACGGAGACTCGAGCGTGCCAGTCTGGAGTGGGGTGAACGTGGCGGGCGTCTCCCTGAAATCCCTGCACCCCGACATGGGCACGGAGTCGGACAAGGAGAACTGGAAGGAGGTGCACAAGCAGGTAGTGGACAGTGCCTATGAAGTCATCAAGCTGAAGGGCTACACCTCGTGGGCGATTGGCCTGTCCGTGGCCGACCTGTCCGAGAGCATCCTGAAGAACCTGCGCCGGGTCCATCCCATCTCCACCATGATCAAGGGCATGTACGGGGTGAATGACGACGTCTTCCTCAGCGTCCCCTGCGTCCTGGGCAACTTGGGCATCACCGACGTGGTGAACATGCCGCTGAAGGCCGATGAAGAGGAGCGGCTGCGCAAGAGCGCCAGTACCCTGTGGGCCATTCAGAAGGAGCTGCAGTTCTGA
Full Trace Sequence: ctcactgactcggagggagaagccgcgcaggagcaacatggcgaccgtaaaggataaactcattcacaatctgctcaaggaggagtcgctcccccaaaacaaggtcaccattgtgggtgtcggggccgttggcatggcctgtgccatcagcgtcctgcagaaggatttggcagatgagcttgcactcgttgatgtgattgaggacaaactaaagggggaaatgatggatctgcagcacggcagcctcttcctccgtacccccaagattgtgtctgggaaagattacagcgtcacagcaaactccaggctggtggtggtgacggcgggggcccggcagcaggagggggagagtcgcctcaatctggttcagcgcaacgtcaacatcttcaagttcatcattcccaacatcgtgaagtacagcccccactgtaccctcctcatcgtctccaaccccgttgacattctgacctacgtggcctggaagatcagtggtttccccaagaatcgcgtgattggcagcggctgcaacttggactccgcccggttccgttacctcatggggcagaagttcgggatccacacccagagctgccacggttgggtcattggggaacacggagactcgagcgtgccagtctggagtggggtgaacgtggcgggcgtctccctgaaatccctgcaccccgacatgggcacggagtcggacaaggagaactggaaggaggtgcacaagcaggtagtggacagtgcctatgaagtcatcaagctgaagggctacacctcgtgggcgattggcctgtccgtggccgacctgtccgagagcatcctgaagaacctgcgccgggtccatcccatctccaccatgatcaagggcatgtacggggtgaatgacgacgtcttcctcagcgtcccctgcgtcctgggcaacttgggcatcaccgacgtggtgaacatgccgctgaaggccgatgaagaggagcggctgcgcaagagcgccagtaccctgtgggccattcagaaggagctgcagttctgacccgttggtccaacttgcactaaggattaggtcaatgtgtgtagtgtttgtgtctctcaagcccctcccacccccgggcagatcccgcccacagaacaaactcctcgggggagtctgggtaatgtccccacttccattggaccagaatggggggtaccggggggggaacccatttagaatgcactttcctgaatgtctcaggttcaaccattcgcccaaagagaaatctatataataatatatgccgccattttgtctgtgtgactccgcccccttgtgtccccgcccactgtctctcgtcctccttgttcccatgtgacaataaatattggacctgccgcctggtcccaactgaaccccagaaaaaaaaaaaaaaa
Translation: MATVKDKLIHNLLKEESLPQNKVTIVGVGAVGMACAISVLQKDLADELALVDVIEDKLKGEMMDLQHGSLFLRTPKIVSGKDYSVTANSRLVVVTAGARQQEGESRLNLVQRNVNIFKFIIPNIVKYSPHCTLLIVSNPVDILTYVAWKISGFPKNRVIGSGCNLDSARFRYLMGQKFGIHTQSCHGWVIGEHGDSSVPVWSGVNVAGVSLKSLHPDMGTESDKENWKEVHKQVVDSAYEVIKLKGYTSWAIGLSVADLSESILKNLRRVHPISTMIKGMYGVNDDVFLSVPCVLGNLGITDVVNMPLKADEEERLRKSASTLWAIQKELQF
Donor tissue: tailbud