ORFeome > lmo4 – XORFeome 2.0

lmo4 – XORFeome 2.0

General Information

Species: Xenopus tropicalis LIM domain only 4, mRNA (cDNA clone MGC:97667 IMAGE:6981252), complete cds
Gene Symbol: lmo4
Gene ID: 548539
ORF gb_acc: MG134444
ORF ID: 12145

ORF full-length analysis tests

Clone type: Full Length
XGC accession: BC090104

Library Location

Plate ID: GDExt11021
Well Location: F08

EST Sequences

Clone: MGC:97667 IMAGE:6981252
Trimmed Sequence: ATGGTGAATAACCGGGTCACCGAGTCGACCACCACGGCAGTGAGCAGTAACGGGGGCCCCCCTAAAGCCTGTGCCGGGTGTGGGGGGAAGATTGCCGATCGCTTCCTGCTTTACTCTATGGAGCGGTACTGGCACACCCGCTGCCTGAAGTGCTCGTGCTGCCAGGCACAACTGGGCGAGATTGGCACCTCCTGTTACACAAAGAGCGGCATGATCCTGTGCCGGAACGACTACATCCGGCTGTTCGGGAGCAGCGGTGCCTGCAGTGCCTGTGGCCAGTCCATCCCTGCCAGCGAGATGGTGATGCGGGCACAGGGCAGCGTTTACCATCTGAAGTGCTTCACATGCGCCACCTGCAGGAACCGACTGGTACCGGGCGACCGATTCCACTACGTCAACGGCGCCATCTTCTGCGAGCACGACCGCCCCACGGGGCTACTGAGCGGCCACTTGAACCCCCTGCAGAGTAACCCCCCCATGCTCCCCGACCAGAAAGTTTGCTAA
Full Trace Sequence: cggagagacgggaacaaggaccaggaatggtgaataaccgggtcaccgagtcgaccaccacggcagtgagcagtaacgggggcccccctaaagcctgtgccgggtgtggggggaagattgccgatcgcttcctgctttactctatggagcggtactggcacacccgctgcctgaagtgctcgtgctgccaggcacaactgggcgagattggcacctcctgttacacaaagagcggcatgatcctgtgccggaacgactacatccggctgttcgggagcagcggtgcctgcagtgcctgtggccagtccatccctgccagcgagatggtgatgcgggcacagggcagcgtttaccatctgaagtgcttcacatgcgccacctgcaggaaccgactggtaccgggcgaccgattccactacgtcaacggcgccatcttctgcgagcacgaccgccccacggggctactgagcggccacttgaaccccctgcagagtaacccccccatgctccccgaccagaaagtttgctaagaggtggagccgagccggatgtgtaccccccgtgccttctgttcatattgccatggcgacacatcagcgacatagaaagaaatctatatataaatatatataaagaaatatattgcccctcctccaggttattttttttttgttcctcgtgccccgcccaccacggacattccgattggtgtttcagtctggaaggaggggataaagagacttgtaaatgacatgtacaaagaacaagacctattttcccattggacggatttgtgggaggagctaaggactctttgtgatgtgcactggatattcctgtttggcgccggccaatcacaagccccgttacggatgcacgcctatatagcgggatactgaggcgcagttggggagtcggcgactcgcagtttggattctgtacaggccaacggatgccgccatgttgtattagacacgccctgggggaggagccttgcaacaagcactgggggttcctccatttatataaagacccctcagggcctgggggatgcagcaggtaggaaatggggggtgaggctgtgcatgctgggaaatgtagttttccagacggttggtggggggggccccgtaataaatggagtcagtgacttcctgttctctccccctgaggctgatgggagatgtagttcaggggcagcagtaggggccagtgttattccgccccaggggatcccagctgctgccctcgtggtgttgctgaactacagccaatgagagagtgaagggttaaagatatgtaagagactgggcttgtaccattctcctcccagggggtgtttggggggggtctcatgacagcacttacataggggggtgagtttggggcacaaatagcactaaatagtgactggccacgccccctgcgctccctggtgtcacatgttcctattggttgttggcaagggggggggggcagtatgttgttgccatggatctgccctgtcagcaatggggcttattatactccctgagctggggcagctgcgtggggcaatgggaatagaattagagacgggggccaatcagagatcagtaaggactgagcagcagaactagagcctgacgtcaataagccccgccccctccatcttacatcactgaatgcagcctgggactaatgagggacccccaaatgtcgctccctaagaatgtggccccaatggttgattccagccatagcgaattggaaagtgactgggggggggacactggctgctcagtaactgccccccgtggggtataatcaggcacgagaaccatacatataggggcagttgtacagtaaatgtgccccccactatctgcctattcatttgtcttctgagattggccaatgggattagggagccctcagtgctgggtgcctaataacaggaaggtgccattccatgcctggggggccccctatccttggcacctcccacccagtgatgctgcagttggggggggggggggggttcctgtgtaaatagttggaataaaggaattttgtgctttctgttgtgttttgtcctgggtttgggcccccgggttggggtttgggcccccgggttggggattgggcccccccgggttggggattgggccccccgggttggggattgggccccccgggttggggattgggccccccgggttggggattgggcccccccgggttggggattgggcccccgggttggggattgggcccccgggttgggggcgggaaccgattttgtaacaaaaagaaaaaaaaaatttaaacaactttgcacttttttcttcccttcacccaattttgatgctgttattgaaaattgaaataaaacttaaagtttccatgaaaaaaaaaaaaaaaaaaaaaaaaa
Translation: MVNNRVTESTTTAVSSNGGPPKACAGCGGKIADRFLLYSMERYWHTRCLKCSCCQAQLGEIGTSCYTKSGMILCRNDYIRLFGSSGACSACGQSIPASEMVMRAQGSVYHLKCFTCATCRNRLVPGDRFHYVNGAIFCEHDRPTGLLSGHLNPLQSNPPMLPDQKVC
Donor tissue: gastrula