ORFeome > LOC496965 – XORFeome 2.0

LOC496965 – XORFeome 2.0

General Information

Species: Xenopus tropicalis hypothetical LOC496965, mRNA (cDNA clone MGC:108083 IMAGE:7004391), complete cds
Gene Symbol: LOC496965
Gene ID: 496965
ORF gb_acc: MG134605
ORF ID: 12329

ORF full-length analysis tests

Clone type: Full Length
XGC accession: BC088764

Library Location

Plate ID: GDExt11022
Well Location: A12

EST Sequences

Clone: MGC:108083 IMAGE:7004391
Trimmed Sequence: ATGACATGTACAATAGACAAGATTTTACAAGACGCGAAGACTCTACTGGAGAGACTAAAGGATCATGACAATGCTGCAGAATCCCTAATTGATCAGTCCAGCGCCCTCCATAAGCGTGTTGAAGCCATGAAAGAAGTTGGAACAGCTATGCCAGAAAAGTACCAAGAAGAATTGGCAGATATAAAAGATGCATCAAAATTGAAACCACATGTACTGCTGTGCCAAGAAAACACACAAATCAGAGATTTACAACAGGAAAACAAAGAATTATGGGTGTCCTTGGAAGAGCATCAGTATGCACTGGAGCTAATCATGAGCAAGTACAGAAAGCAGATGCTGCAACTGGTTGCAAATAAAAAACCAGCTCCCACTGAACCAGTATTAGAAGCCCATAAGACTTTTTCTTCTGATCTAGAATGTCAGATAGATAGAATATGTGTAATGGGGGATATCATGAGAGATGCAATTCAGCTGGATGAAGACAAGGCATATAATATTCAAGAGAAACTAGCTCAGCTAGAGCTAGAAAACAAGGAGCTTCGGGAAATCCTATCCACGAGTAAGGAATCTCTACATTCAAGCAAAAGGGAATCAGAGTGGAACTTTTCTGAGAAAACCCAATGA
Full Trace Sequence: ggcggggcaattggctctgtagcaatgacatgtacaatagacaagattttacaagacgcgaagactctactggagagactaaaggatcatgacaatgctgcagaatccctaattgatcagtccagcgccctccataagcgtgttgaagccatgaaagaagttggaacagctatgccagaaaagtaccaagaagaattggcagatataaaagatgcatcaaaattgaaaccacatgtactgctgtgccaagaaaacacacaaatcagagatttacaacaggaaaacaaagaattatgggtgtccttggaagagcatcagtatgcactggagctaatcatgagcaagtacagaaagcagatgctgcaactggttgcaaataaaaaaccagctcccactgaaccagtattagaagcccataagactttttcttctgatctagaatgtcagatagatagaatatgtgtaatgggggatatcatgagagatgcaattcagctggatgaagacaaggcatataatattcaagagaaactagctcagctagagctagaaaacaaggagcttcgggaaatcctatccacgagtaaggaatctctacattcaagcaaaagggaatcagagtggaacttttctgagaaaacccaatgatagcctctcattgttgaaagaagccaaacttccagaaagcagaaactcatgctgcccagcaccaaatctttggtggcaacaatcagtgaaaacattattttttctgtctggatgcaaaactgcacccttgtaagagacaatggcattcatcacactgcaaagtactaggtctttcaccctgcaaaacactaaaactgaggaacctgaacgcagtgttttactgatgtttacagcagtaaatgattcatcttaatgttatataactatatcttaagaaatacagctatatttaatttttaaaagtagtagtatagtattcatttctgatacagtagttaaacatttctcttggtatgactgaattccaaagatacttagttttgttttcttcagtttttgctgtgaacctgagattaatgtgatgtatggagagacacaaagaaaataaataaataaataaaataaaataaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaa
Translation: MTCTIDKILQDAKTLLERLKDHDNAAESLIDQSSALHKRVEAMKEVGTAMPEKYQEELADIKDASKLKPHVLLCQENTQIRDLQQENKELWVSLEEHQYALELIMSKYRKQMLQLVANKKPAPTEPVLEAHKTFSSDLECQIDRICVMGDIMRDAIQLDEDKAYNIQEKLAQLELENKELREILSTSKESLHSSKRESEWNFSEKTQ
Donor tissue: