ORFeome > LOC548701 – XORFeome 2.0

LOC548701 – XORFeome 2.0

General Information

Species: Xenopus tropicalis hypothetical protein LOC548701, mRNA (cDNA clone MGC:97609 IMAGE:6978289), complete cds
Gene Symbol: LOC548701
Gene ID: 548701
ORF gb_acc: MG134426
ORF ID: 12125

ORF full-length analysis tests

Clone type: Full Length
XGC accession: BC093457

Library Location

Plate ID: GDExt11021
Well Location: A01

EST Sequences

Clone: MGC:97609 IMAGE:6978289
Trimmed Sequence: ATGGCCTCAGCGCTGTACGCCTGCACCAAGTGTCACCAGCGATACCCGTTCGAAGAGCTCTCCCAGGGGCAGCAGCTGTGCAAGGAGTGCCGAATAGCTCATCCCATTGTGAAATGCACATACTGTAGATCAGAATTTCAGCAGGAGAGTAAAACCAACACAATATGCAAGAAGTGTGCGCAAAATGTTAAGCAATTTGGCACTCCCAAGCCTTGCCAGTACTGTAACATCATAGCTGCATTCATTGGCACAAAATGTCAGCGCTGCACCAACTCAGAGAAAAAATATGGACCTCCACAGACATGTGAACAGTGCAAGCAGCAATGCGCTTTTGATCGGAAGGAGGAGGGAAGAAGAAAGGTTGATGGAAAGTTATTGTGCTGGCTTTGTACCCTCTCCTATAAGAGGGTTCTTCAAAAGACTAAAGAGCAACGGAAAAGTCTGGGATCAACCCATTCAAATTCGTCTTCCTCTTCTCTTACGGAGAAAGATCAGCATCATTCTAAACATCACCACCACCACCATCATCACCACAGGCACAGCAGCAGCCACCACAAAATTAGTAGTCTGAGTCCAGAACCAGAGCAGGGAATATGGAAACAAAGTCATAAGTCCAGTACCGTGATTCAGAATGAAACTCCAAAGAAAAAGCCCAAACTGGAATTCAAGCCATCTAATGGAGATAGTAGCTCTATCAATCAGTCCACGGACAGTGGAGGCACAGACAACTTTGTCCTGATCAGCCAGTTAAAGGAGGAAGTGATGTCTCTGAAGCGTCTCTTGCAGCAAAGAGATCAAACTATTCTTGAAAAGGACAAAAAGCTAACCGAGTTGAAAGCAGACTTCCAATACCAAGAGAATAATCTGAGGACAAAGATGAACGGCATGGATAAAGCTCACAAAGACTTTGTCGAGCAGTTGCAGGGCAAGAACCGAGAATTACTGAAGCAAGTTGCAGCTTTGTCAAAGGGTAAAAAATTTGACAAAAGTGGGAGTATACTTACATCTCCTTGA
Full Trace Sequence: gttcccagtatggcctcagcgctgtacgcctgcaccaagtgtcaccagcgatacccgttcgaagagctctcccaggggcagcagctgtgcaaggagtgccgaatagctcatcccattgtgaaatgcacatactgtagatcagaatttcagcaggagagtaaaaccaacacaatatgcaagaagtgtgcgcaaaatgttaagcaatttggcactcccaagccttgccagtactgtaacatcatagctgcattcattggcacaaaatgtcagcgctgcaccaactcagagaaaaaatatggacctccacagacatgtgaacagtgcaagcagcaatgcgcttttgatcggaaggaggagggaagaagaaaggttgatggaaagttattgtgctggctttgtaccctctcctataagagggttcttcaaaagactaaagagcaacggaaaagtctgggatcaacccattcaaattcgtcttcctcttctcttacggagaaagatcagcatcattctaaacatcaccaccaccaccatcatcaccacaggcacagcagcagccaccacaaaattagtagtctgagtccagaaccagagcagggaatatggaaacaaagtcataagtccagtaccgtgattcagaatgaaactccaaagaaaaagcccaaactggaattcaagccatctaatggagatagtagctctatcaatcagtccacggacagtggaggcacagacaactttgtcctgatcagccagttaaaggaggaagtgatgtctctgaagcgtctcttgcagcaaagagatcaaactattcttgaaaaggacaaaaagctaaccgagttgaaagcagacttccaataccaagagaataatctgaggacaaagatgaacggcatggataaagctcacaaagactttgtcgagcagttgcagggcaagaaccgagaattactgaagcaagttgcagctttgtcaaagggtaaaaaatttgacaaaagtgggagtatacttacatctccttgaggaaaagtaaaacaggaggacacagcgtaattctgtgaagcccttaaaaatacttaggggataaacgggtaaactctcagtaccgtggtaatcgttttttaaagctagtacttgggtttttattactactaagtctcacacaaagcaacttcaactggcttgaagaccattttgtgtcagttctgcagtgggaggaaacactacagcactgtccttcagtcacaaggcaataaacacaggaataaaacgtcaaaacaacagaataatatcagtatgtggccttacattacctactgatgctctcactcactagctgctttcatcctacgtggcacacacattcaccttttggttttattgtaagtagatgtttgtattagactccggcaggttgaattaaggtgcttaaccctctcagtgctggactgacttgcagtgtatttattgtctgtacattgcaaaccccctcagcattggattaggttaaatgaactactgtgtaaatgaagagatttattgtagatcgacatttcatttctgaaaatcctaaatgtattgtatcgtgcctgctggatgaaaggtgtgctttttgtaccgcctgttgtgaatttatacttgcaagtgccttttgttgtaagatttaatttattcaagtatttacgaggaggggagacgtgtacataatgtgtataatgttcttatgtggaggttttatcacttatgtactgatctgtaagcagagggccacagatcaaagctatagggccagaaattgggaagcttttttttttttctttccagatgttgaatgaacttttgccaatccctttggctactgtgggttgtatctgaatgtctggggggctgaagcttgggtggtgctgataggagtgcaagcagttgtgttgatctctgagcagaggccatactcatggctctggggtgtggatagccatgtaacctgtactcatcatggccatatttgtgtagtttagtaggttttatcttgtacatactaaagctgttcgtaaaataaccatgctgccacttctgcaggcagagcgtctataacccttgtaatcgtgcttttgtggcactagatggaatcccgacatcatggaatctctagcaggacatgcagctgtaggtagtttatgcaagaagctggtaccgtagcctgcagttgtacatatcactttatgtgcatttcaaaggtaacttcctgcgtcttgtaaaaaataattttctgatcctcccccacatatatactgtttgtttttgtttttgttctttttttctttaccaggtggccatattttaaaatattcattctttgtgtgtagagagagtttatgcatgtacaggtactaaatctccaccttcctgtcatcataacacactccagggaatttttaaatactttgtattatatacaatggccggtgtgtgtatggttgttctatgtaaagctgtaaccaacctgtctatttaaaactacattgttatgatccaaattaaagtttgcccttagatttcagagacctatacccactagtaacatttttttgcaatttttagatttttttttttttatctggcacgggatcgccctctgccactttgtgtttaaaactgctaatatcatgacggctaaaataaaatgtcaagtagatttcctcttactaagtgcttggcaagcactatcattttagtcttgtgtttgtcattgggagtattaatctatatacatgagacactcttacaataccagcacattttatgcttaatgccagcccacatgataagtgtgtgtgatttttagacccaataatcggcgactgaaacgagtggctaaaatgcctgcgggcaccgtgctttttatgtgactgtgtgtgtgtgtcttaaatatacctttttatattctgtcttaaacagagggaaattagaaaaaaataaaaatgtctgcaagtagcatgatgggcttgcatgcaggattagccccggtttttgtcgcccagccggtgggttctacactcctatcacctcactctaaaacagcactctagtgattcccatgcagtctcttattcgtagtgacactgctgctcattctcccccctggctgctacatctagagtgcagcagaaccagtctgtctatgcattttcctcctattcggtccctagtgctatgggcctgtgcacaaacaaggggagcattacttgccaataactcatagtactcctgttgtggagctgttacttctcaggatcaactaccgcacgttagcttgttcttttctttacagcttacagaaagcgcctactaaaaatgagctttggtaggaggatttattttccatatgtgatggtaaaaccacaaatgtccctgtgttggtgccagccaaccatggcgtgcctgctaaaagctgtatggtttgtacatttagatattagatcttaatcatgacttgaaggacatgatctaacgtttgtaacaggaatgttcacaaacctccacctccatcaagggaattctgttatcccttccccattaattctttagttttatgtgtgccagaccgtgtcccaagttatgtctgaccttataactcaaaggtggggtgtgcattaatctgaggcagtaacatacagtatccagtactggtaattctaaagcaagtggagactgacaaccttcagctcttaatattgcctgggagactgacaaccttcagctcttaatattgccaataggctctgttacactacctgcttattggggcttaagatggccatacagtgaaagatctgctcattttagtgaccctgtggtgggcgatatcaggtaggtccaagggccaaagcttccaatcacattgacagcataggatgtaggccgtcggggcaaggaccaatcaacatctgggtgatttttggccaggtatcgattggaatagacccctctaatggctccatatgcagatcaataaactgccaacttggtccttcagcagctttaatcagccagtgtatggccacctttagctagggcctctacataccaatgcaatgatgatagagcctccagcatgaacaatggagagaacatgctttgggggtatttagagcagggtagaaattgaaatatttcccattaattataattgtgagcttgcatgggagattataagttacaatttttcccaataatgaaacaaaatagtgtctttaggcgcaaatagaaactgtataaaaatgttcctttaccttcataagcatagtgggcagccatacgctctgcaatgctgttattatacaatgagcccccccctgctttcctggctctgccactttctatttctattcacaaatgaagtacaaaattctaatgtttttagaagctggaagttattttgtttggttctataaaaccttcacaaagtatatagaaaaaaagggtaaatgtccaagtaaactttgttgctattctgagatgatttgtatttgaatttgtttttgcttgtttctgcctctaattcagataacacatccagaccgagcaccatcgatcaaacttcattcagattctgcctataacataaatcgcttgcaaacagtggcatttgtgttgcaataccatgaaggatgtacttaccctttagcgccacaaacaactatttaatatttcagaattttgttttgcggggtggatttttttttatttttttaggggcttcacagtattaggtccatctttaaatattatatctatgtcataacctcattttttaacttgaattatttttttttttatttaaaaaaacaaaaacaaataaaaaaaaataaatacaaaagtaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaa
Translation: MASALYACTKCHQRYPFEELSQGQQLCKECRIAHPIVKCTYCRSEFQQESKTNTICKKCAQNVKQFGTPKPCQYCNIIAAFIGTKCQRCTNSEKKYGPPQTCEQCKQQCAFDRKEEGRRKVDGKLLCWLCTLSYKRVLQKTKEQRKSLGSTHSNSSSSSLTEKDQHHSKHHHHHHHHHRHSSSHHKISSLSPEPEQGIWKQSHKSSTVIQNETPKKKPKLEFKPSNGDSSSINQSTDSGGTDNFVLISQLKEEVMSLKRLLQQRDQTILEKDKKLTELKADFQYQENNLRTKMNGMDKAHKDFVEQLQGKNRELLKQVAALSKGKKFDKSGSILTSP
Donor tissue: tailbud