ORFeome > lsm4 – XORFeome 2.0

lsm4 – XORFeome 2.0

General Information

Species: Xenopus tropicalis LSM4 homolog, U6 small nuclear RNA associated (S. cerevisiae), mRNA (cDNA clone MGC:76085 IMAGE:5308012), complete cds
Gene Symbol: lsm4
Gene ID: 395002
ORF gb_acc: MG132755
ORF ID: 10058

ORF full-length analysis tests

Clone type: Full Length
XGC accession: BC064199

Library Location

Plate ID: GDExt11001
Well Location: F02

EST Sequences

Clone: MGC:76085 IMAGE:5308012
Trimmed Sequence: ATGTTGCCGTTATCATTGTTAAAAACTGCTCAGAATCACCCAATGTTGGTGGAATTAAAGAATGGTGAAACATACAACGGTCATTTAGTGAGCTGTGACAACTGGATGAACATCAATCTAAGAGAAGTTATTTGTACTTCACGGGATGGTGATAAATTTTGGAGGATGCCAGAGTGCTATATACGTGGAAGCACAATTAAATATTTGCGGATCCCTGATGAAATTATTGATATGGTAAAGGAGGAAGTGATGTCAAAAGGCAGAGGTCGTGGAGGCATGCAGCAACAAAAACAGATGAAGGGTAGAGGAGCCGGTGGAGCTGGGCGAGGTGTCTTTGGAGGGCGAGGCAGGGGAGTCCCTGGTGGAGGTAGGGGCCAGCAAGACAAAAAGCCAGGCCGGCAGTCTGGGAAACAGTGA
Full Trace Sequence: tgagggagcgcggtacagagcgaaacatgttgccgttatcattgttaaaaactgctcagaatcacccaatgttggtggaattaaagaatggtgaaacatacaacggtcatttagtgagctgtgacaactggatgaacatcaatctaagagaagttatttgtacttcacgggatggtgataaattttggaggatgccagagtgctatatacgtggaagcacaattaaatatttgcggatccctgatgaaattattgatatggtaaaggaggaagtgatgtcaaaaggcagaggtcgtggaggcatgcagcaacaaaaacagatgaagggtagaggagccggtggagctgggcgaggtgtctttggagggcgaggcaggggagtccctggtggaggtaggggccagcaagacaaaaagccaggccggcagtctgggaaacagtgatgtcttgatactgctgtccttttgccagagacattcgtttagtatcgactgtatggtcacgcctcaactctgcaaaatatttaaaatgttagtctcccaactctcagcacaccagcaattttcaaaagaactgcatttttttcctgttcactcctccctccttccacaatgtagaacccacttaaagaggcatgtctcctgtaagagaggacacaagccagatccagatgtcaaaacatgattaacgccatttatttctgtctgtctgtgggaggtcttcacatcctaacctgcaaatgaacttagcccatggcatcaaaaggtcatttgggctaaactccaaaagcaagggggttggggtgtgtagtgagaagggtacacatcacttgtaacaactgtgcagcataagtataccggcttgtcagcaaagctagtttgaagtcaacacatttgaacttcattatgatttaaccacttctctgccatagctaggtgaaggagataattgcagtgcaatgtagccatgcctcctaaataaatgtgaaatctctcagaaatatttggggactgttgggagaaggattttttttggtccgttaaattatgtttgcatatgaaaaggttaaatggctttcacagatacattttcaaagtgtaatacaataccctctaagaatggagaatctatatagcaatttgtgactggcacagtagatgtatatgagtgattaagcattcagctttttggctaatttcataagcccaagtcccaggagggctgcagtttgctgaatagatgcccccatggagaatataaaaagcacatttctccacttgtatctggttatggaatgttctaaatgagtagaggttacagttcctcaattgcattggatttgtgttcaaatattttggtgtagccatggttactattgagctgatgattttgtgctttttttttccctctcacagaaaattcacatttttgtccctcaaagaaattggtgttttctaaaacagccttattttttcttttacacacttgtataatgcacttaaaaatctggttggctgccttttttcactttttatgttttttgtttagttgtctggtaaaagactatgattcacttaagaaaaaaaatgggcagaatattgagaggaaattaggggaaaaaaaaatgtgtgttttgttctggaaaaccttttcttgttacaaagagtataagagtgctgtgacacctttttttttttctttaaaataaaatattagcaatgaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaa
Translation: MLPLSLLKTAQNHPMLVELKNGETYNGHLVSCDNWMNINLREVICTSRDGDKFWRMPECYIRGSTIKYLRIPDEIIDMVKEEVMSKGRGRGGMQQQKQMKGRGAGGAGRGVFGGRGRGVPGGGRGQQDKKPGRQSGKQ
Donor tissue: gastrula