ORFeome > lsm4 – XORFeome 2.0

lsm4 – XORFeome 2.0

General Information

Species: Xenopus tropicalis LSM4 homolog, U6 small nuclear RNA associated (S. cerevisiae), mRNA (cDNA clone MGC:89032 IMAGE:7005032), complete cds
Gene Symbol: lsm4
Gene ID: 395002
ORF gb_acc: MG134148
ORF ID: 11778

ORF full-length analysis tests

Clone type: Putative Full Length
XGC accession: BC082491

Library Location

Plate ID: GDExt11017
Well Location: D04

EST Sequences

Clone: MGC:89032 IMAGE:7005032
Trimmed Sequence: ATGTTGCCGTTATCATTGTTAAAAACTGCTCAGAATCACCCAATGTTGGTGGAATTAAAGAATGGTGAAACATACAACGGTCATTTAGTGAGCTGTGACAACTGGATGAACATCAATCTAAGAGAAGTTATTTGTACTTCACGGGATGGTGATAAATTTTGGAGGATGCCAGAGTGCTATATACGTGGAAGCACAATTAAATATTTGCGGATCCCTGATGAAATTATTGATATGGTAAAGGAGGAAGTGATGTCAAAAGGCAGAGGTCGTGGAGGCATGCAGCAACAAAAACAGATGAAGGGTAGAGGAGCCGGTGGAGCTGGGCGAGGTGTCTTTGGAGGGCGAGGCAGGGGAGTCCCTGGTGGAGGTAGGGGCCAGCAAGACAAAAAGCCAGGCCGGCAGTCTGGGAAACAGTGA
Full Trace Sequence: agggagcgcggtacagagcgaaacatgttgccgttatcattgttaaaaactgctcagaatcacccaatgttggtggaattaaagaatggtgaaacatacaacggtcatttagtgagctgtgacaactggatgaacatcaatctaagagaagttatttgtacttcacgggatggtgataaattttggaggatgccagagtgctatatacgtggaagcacaattaaatatttgcggatccctgatgaaattattgatatggtaaaggaggaagtgatgtcaaaaggcagaggtcgtggaggcatgcagcaacaaaaacagatgaagggtagaggagccggtggagctgggcgaggtgtctttggagggcgaggcaggggagtccctggtggaggtaggggccagcaagacaaaaagccaggccggcagtctgggaaacagtgatgtcttgatactgctgtccttttgccagagacattcgtttagtatcgactgtatggtcacgcctcaactctgcaaaatatttaaaatgttagtctcccaactctcagcacaccagcaattttcaaaagaactgcatttttttcctgttcactcctccctccttccacaatgtagaacccacttaaagaggcatgtctcctgtaagagaggacacaagccagatccagatgtcaaaacatgattaacgccatttatttctgtctgtctgtgggaggtcttcacatcctaacctgcaaatgaacttagcccatggcatcaaaaggtcatttgggctaaactccaaaagcaagggggttggggtgtgtagtgagaagggtacacatcacttgtaacaactgtgcagcataagtataccggcttgtcagcaaagctagtttgaagtcaacacatttgaacttcattatgatttaaccacttctctgccatagctaggtgaaggagataattgcagtgcaatgtagccatgcctcctaaataaatgtgaaatctctcagaaatatttggggactgttgggagaaggattttttttggtccgttaaattatgtttgcatatgaaaaggttaaatggctttcacagatacattttcaaagtgtaatacaataccctctaagaatggagaatctatatagcaatttgtgactggcacagtagatgtatatgagtgattaagcattcagctttttggctaatttcataagcccaagtcccaggagggctgcagtttgctgaatagatgcccccatggagaatataaaaagcacatttctccacttgtatctggttatggaatgttctaaatgagtagaggttacagttcctcaattgcattggatttgtgttcaaatattttggtgtagccatggttactattgagctgatgattttgtgcttttttttttccctctcacagaaaattcacatttttgtccctcaaagaaattggtgttttctaaaacagccttattttttcttttacacacttgtataatgcacttaaaaatctggttggctgccttttttcactttttatgttttttgtttagttgtctggtaaaagactatgattcacttaagaaaaaaaatgggcagaatattgagaggaaattaggggaaaaaaaaatgtgtgttttgttctggaaaaccttttcttgttacaaagagtataagagtgctgtgacaccttttttttttctttaaaataaaatattagcaatgaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaa
Translation: MLPLSLLKTAQNHPMLVELKNGETYNGHLVSCDNWMNINLREVICTSRDGDKFWRMPECYIRGSTIKYLRIPDEIIDMVKEEVMSKGRGRGGMQQQKQMKGRGAGGAGRGVFGGRGRGVPGGGRGQQDKKPGRQSGKQ
Donor tissue: