ORFeome > mapkapk5 – XORFeome 2.0

mapkapk5 – XORFeome 2.0

General Information

Species: Xenopus tropicalis mitogen-activated protein kinase-activated protein kinase 5, mRNA (cDNA clone MGC:89580 IMAGE:6994218), complete cds
Gene Symbol: mapkapk5
Gene ID: 448643
ORF gb_acc: MG133920
ORF ID: 11513

ORF full-length analysis tests

Clone type: Putative Full Length
XGC accession: BC076988

Library Location

Plate ID: GDExt11015
Well Location: D06

EST Sequences

Clone: MGC:89580 IMAGE:6994218
Trimmed Sequence: ATGTCTCAGAATAACGCCATGGACAGAACAATAAAGGACACCTCAATCTTAGAAGAGTACAACATTAACTGGACACAGAAGCTTGGTGCTGGAATTAGTGGCCCTGTCAGAGTGTGTGTAAAAAAGACAACGCAAGAGCGGTTTGCACTGAAAATCCTCGTTGATCGACCTAAAGCCAGAAATGAGGTACGATTACACATGCTGTGTGCAGCACATCCAAACATTGTACAGATTATTGACGTGTATGCAAACAGTGTGCAGTTCCCCCATGAGTCTAGCCCAAGGGCACGGCTCCTAATTGTTATGGAGATGATGGAGGGGGGCGAGCTGTTTCACAGAATCAGCCAGCACCGGCACTTCACTGAGAAGCAAGCCAGCCAAGTAACAAAGCAGATTGCTTTGGCGATAAAGCATTGTCACTCACTAAACATTGCCCATAGAGACCTCAAGCCAGAGAACCTGCTCTTCAAGGACAACTCACTGGATGCTCCAGTTAAATTATGTGATTTTGGTTTTGCAAAAATAGACCAGGGAGATCTAATGACACCACAGTTTACCCCATACTACGTAGCTCCACAGGTTTTGGAGGCACAGCGAAGACACCAGAAGGAAAAGTTTGGGATCATTCCTACCTCACCAACACCGTACACTTACAACAAGAACTGTGACTTGTGGTCCTTAGGTGTTATAATTTATGTGATGCTCTGTGGCTACCCTCCTTTTTACTCCAAACACCACAGTCGAACCATTCCAAAGGACATGAGGAAAAAGATCATGACTGGAAGTTTTGAGTTCCCGGAGGAAGAATGGAGCCAGATCTCTGAAATGGCAAAAGATATTGTGAGAAAGCTACTGAAGGTTAAGCCAGAGGAGCGGCTCACTATCGAAGGCGTTCTAGACCACCCTTGGCTGAACTCAACTGAAGCGCTGGATAACATTTTACCATCTGCACAGATGATGATGGACAAGGCAGTGGTTGCTGGGATACAGCAAGCTCATGCTGAACAGCTTGCCAACATGAGAATACAAGACTTGAAAGTCAACTTGAAACCATTAAATATTGTCAACAATCCCATACTACGAAAGAGAAAGCTGCTAGGAACAAGACCAAAAGATAATGTTTACATCCAGGATCCTGAAAATGAAACAGAAGACTCGAATGTTGCACTGGAAAAACTTCGAGATGTAATTGCACAGTGCATACTACCACAGGAAGGAGAAAATGAAGATGAGAAGTTAAATGAAGTAGTACTAGAAGCTTGGCAGTACAATAAAGACTGCAAGCTATTGCGAGACACCCTGCAGAGTTTCAGCTGGAATGGTCGAGGATTCTCGGACAAAGTCGACCGGCTGAAACTGGCAGAAATAGTAAAGCAAGTTATTGAAGAGCAAACAAACTCTCCAGAGGATTCACAACTGTTCAGGGCAGTGGCGCAGAGGTGGCCAAGCCACAGATTTCCACCTACAGCTCACAGAATCCTGGGCTAA
Full Trace Sequence: cggggctcgtccgacggtaccttcatgtctcctcctctcctctgaccccagcggttccctttcccagagctgaccagaggggatgtctcagaataacgccatggacagaacaataaaggacacctcaatcttagaagagtacaacattaactggacacagaagcttggtgctggaattagtggccctgtcagagtgtgtgtaaaaaagacaacgcaagagcggtttgcactgaaaatcctcgttgatcgacctaaagccagaaatgaggtacgattacacatgctgtgtgcagcacatccaaacattgtacagattattgacgtgtatgcaaacagtgtgcagttcccccatgagtctagcccaagggcacggctcctaattgttatggagatgatggaggggggcgagctgtttcacagaatcagccagcaccggcacttcactgagaagcaagccagccaagtaacaaagcagattgctttggcgataaagcattgtcactcactaaacattgcccatagagacctcaagccagagaacctgctcttcaaggacaactcactggatgctccagttaaattatgtgattttggttttgcaaaaatagaccagggagatctaatgacaccacagtttaccccatactacgtagctccacaggttttggaggcacagcgaagacaccagaaggaaaagtttgggatcattcctacctcaccaacaccgtacacttacaacaagaactgtgacttgtggtccttaggtgttataatttatgtgatgctctgtggctaccctcctttttactccaaacaccacagtcgaaccattccaaaggacatgaggaaaaagatcatgactggaagttttgagttcccggaggaagaatggagccagatctctgaaatggcaaaagatattgtgagaaagctactgaaggttaagccagaggagcggctcactatcgaaggcgttctagaccacccttggctgaactcaactgaagcgctggataacattttaccatctgcacagatgatgatggacaaggcagtggttgctgggatacagcaagctcatgctgaacagcttgccaacatgagaatacaagacttgaaagtcaacttgaaaccattaaatattgtcaacaatcccatactacgaaagagaaagctgctaggaacaagaccaaaagataatgtttacatccaggatcctgaaaatgaaacagaagactcgaatgttgcactggaaaaacttcgagatgtaattgcacagtgcatactaccacaggaaggagaaaatgaagatgagaagttaaatgaagtagtactagaagcttggcagtacaataaagactgcaagctattgcgagacaccctgcagagtttcagctggaatggtcgaggattctcggacaaagtcgaccggctgaaactggcagaaatagtaaagcaagttattgaagagcaaacaaactctccagaggattcacaactgttcagggcagtggcgcagaggtggccaagccacagatttccacctacagctcacagaatcctgggctaacaactgcttcatgatgggctatcaccctctgcatctgctgctggaatctgaatcttatacgaaatacaaattgtttcatgctctcatccaatttagttatgcttctcgtttgacctttagaggatgtttggccctaaccctgtgctgtttttcggctttagtaggaaggagttgggctggacacctagtttgctggaggccacgccttgtctacaacacctagttctgttgcttagcttctcatttccatatttaatgtactaaatttgttttatttatcttgaaatgtttcctgtatgatgtcatgttttcagaccagtattataatgtaaataagcatcattgtatataaaatgattttccttacaaaaaaaaaaaaaaaaaaaaaaaaa
Translation: MSQNNAMDRTIKDTSILEEYNINWTQKLGAGISGPVRVCVKKTTQERFALKILVDRPKARNEVRLHMLCAAHPNIVQIIDVYANSVQFPHESSPRARLLIVMEMMEGGELFHRISQHRHFTEKQASQVTKQIALAIKHCHSLNIAHRDLKPENLLFKDNSLDAPVKLCDFGFAKIDQGDLMTPQFTPYYVAPQVLEAQRRHQKEKFGIIPTSPTPYTYNKNCDLWSLGVIIYVMLCGYPPFYSKHHSRTIPKDMRKKIMTGSFEFPEEEWSQISEMAKDIVRKLLKVKPEERLTIEGVLDHPWLNSTEALDNILPSAQMMMDKAVVAGIQQAHAEQLANMRIQDLKVNLKPLNIVNNPILRKRKLLGTRPKDNVYIQDPENETEDSNVALEKLRDVIAQCILPQEGENEDEKLNEVVLEAWQYNKDCKLLRDTLQSFSWNGRGFSDKVDRLKLAEIVKQVIEEQTNSPEDSQLFRAVAQRWPSHRFPPTAHRILG
Donor tissue: neurula