ORFeome > mfap2 – XORFeome 2.0

mfap2 – XORFeome 2.0

General Information

Species: Xenopus tropicalis microfibrillar-associated protein 2, mRNA (cDNA clone MGC:75763 IMAGE:5381769), complete cds
Gene Symbol: mfap2
Gene ID: 394596
ORF gb_acc: MG132906
ORF ID: 10271

ORF full-length analysis tests

Clone type: Full Length
XGC accession: BC061294

Library Location

Plate ID: GDExt11004
Well Location: D03

EST Sequences

Clone: MGC:75763 IMAGE:5381769
Trimmed Sequence: ATGAGGGCGGCGTGTCTCTTCCTGCTCTCTGTGCATGGGATATTTGCTCAATTGGAAACGGACCCTCTCTTCCCATATGGCGGCAACCAAGATATCTCCAATTATTACTATTATGATGCAGACCCAACCGGGGGCCCATTCCCACCCCCAGACCAAGATCAGCAGCAGAACGTGCAACAGCAGCAGTTACAGCTGCAATTCGAAACAATTGACCAGGAACCTCAGCAGCAACAGCGACAGCAGCAGCAAGAGATTATCGTCGTGCCAACCCTAGACCCTGCTGTGACTGAGCCGACAGAGCCGGGACCTCTGGATTGTCGGGAGGAGCAGTACCCCTGTACCCGCCTGTATTCTGTACATAAACCCTGCAAGCAGTGTCTCAATGAAATCTGCTTTTACAGCCTGCGGCGCATGTACGTCATCAACAGGGAGATCTGCGTCCGTACTGTGTGTGCGCACGAGGAGCTGCTGAGAGCCGACCTGTGCCGGGACAAGTTCTCTCGCTGCGGGGTGATGGCCAATAGCGGGATGTGCCAGTCCCTGGGATCCCACTGTTCCAAGAGCTGCGGGGGCTGCTAA
Full Trace Sequence: ctgtatcacagctgctcctggggacctgacgtgccgctctacccaagtggcacaaagcaccgaccgggttctgtccaactgacaccatgagggcggcgtgtctcttcctgctctctgtgcatgggatatttgctcaattggaaacggaccctctcttcccatatggcggcaaccaagatatctccaattattactattatgatgcagacccaaccgggggcccattcccacccccagaccaagatcagcagcagaacgtgcaacagcagcagttacagctgcaattcgaaacaattgaccaggaacctcagcagcaacagcgacagcagcagcaagagattatcgtcgtgccaaccctagaccctgctgtgactgagccgacagagccgggacctctggattgtcgggaggagcagtacccctgtacccgcctgtattctgtacataaaccctgcaagcagtgtctcaatgaaatctgcttttacagcctgcggcgcatgtacgtcatcaacagggagatctgcgtccgtactgtgtgtgcgcacgaggagctgctgagagccgacctgtgccgggacaagttctctcgctgcggggtgatggccaatagcgggatgtgccagtccctgggatcccactgttccaagagctgcgggggctgctaaggatctgctgggggggccccgtccccctcccccactcggggggcttcccacacagggtggggttactagtattattgtatctgtattgtactgtatgtgccccgagggctccgagcctccgtatctactgtttatatgatagccggccctgctcactgcaccggtagccaatggctagtggcttctcataacggccacgctgccagcctgggggggtcccatgggaaaacagaagcccccccacaggcaatgggctcctaggcctcttccttcttcccatcatgcatttcactcctatgttcccctttcttaaccctttgtcccccaatctccttcattcctcattgcacttgtatttccagatgtccccccacatatatacattctgcccccccccagtctcacataagggctgatgttacttgacttctttttgtaattgttttgtacaaaagatgaataaagtgcagaattttaccttgtgctggaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaa
Translation: MRAACLFLLSVHGIFAQLETDPLFPYGGNQDISNYYYYDADPTGGPFPPPDQDQQQNVQQQQLQLQFETIDQEPQQQQRQQQQEIIVVPTLDPAVTEPTEPGPLDCREEQYPCTRLYSVHKPCKQCLNEICFYSLRRMYVINREICVRTVCAHEELLRADLCRDKFSRCGVMANSGMCQSLGSHCSKSCGGC
Donor tissue: tadpole