ORFeome > mgc107745 – XORFeome 2.0

mgc107745 – XORFeome 2.0

General Information

Species: Xenopus tropicalis hypothetical protein mgc107745, mRNA (cDNA clone MGC:107745 IMAGE:7002607), complete cds
Gene Symbol: mgc107745
Gene ID: 613080
ORF gb_acc: MG134604
ORF ID: 12328

ORF full-length analysis tests

Clone type: Full Length
XGC accession: BC096387

Library Location

Plate ID: GDExt11022
Well Location: B11

EST Sequences

Clone: MGC:107745 IMAGE:7002607
Trimmed Sequence: ATGTGGGGGTTCCTAACAGAGCTGGGGGTGTGCATAGTACTGATAGGATTCTTTGTGGTAAGCTGTCAGAATGTAGTCCATATTGTTCGGGGAGCTGGTAAATTTGTTCTTCGCCGACTCCACACTGAGCTCGACAAAGAACTTGGGGAAGGAGGTGGAGAAGATGATGAGGAAACACTGACCACCAAGGTTGTGAGGAGGAGGGTCATCGTCAAGGGGAACGAAGTCCCAGATATTCCTGGGGAACAGGTGACAGAGGAAGAGTTCACAGATGAGCAAGGGAACATTGTGACAAAGAAGATAGTCCGGAAGGTTCTACGCAGAGTGGGTCCACCAGGAACCACAGATTTAGGGGATAATGAGGACCTTTTGATAGAGGGGACACTGCAGGAACCAGAAGACCTGGAAAGTGAAACCCCAAATTACCTGAAGTATGCTGTACTGCACCGAGAGAATTACACTTCAAGTACAAGCTACTGA
Full Trace Sequence: cagctttaactttgtctgaagggggtgaagctaccggtggatttacagtaggaaaactcccatttggagttggtaggaagctgaagttatggattaagccttgtacctgttatacctgacaaaacatcgacaaataatgtttattcttggggaggggtagcccaaatggatgcaaagggctcagcattagaataagggacatttcacggtatgctatgccagttgatgttttagtttaacagactgtgaaagaacccaaataccggtattagaagaatactaaaatggctttcattcagctgtaggtattatacaaaggactgcagtgaaggtttgtcactggtatataacaaaatagaattgactgaacaagtgttatcccctcagttgagagcaggacaggatgtgggggttcctaacagagctgggggtgtgcatagtactgataggattctttgtggtaagctgtcagaatgtagtccatattgttcggggagctggtaaatttgttcttcgccgactccacactgagctcgacaaagaacttggggaaggaggtggagaagatgatgaggaaacactgaccaccaaggttgtgaggaggagggtcatcgtcaaggggaacgaagtcccagatattcctggggaacaggtgacagaggaagagttcacagatgagcaagggaacattgtgacaaagaagatagtccggaaggttctacgcagagtgggtccaccaggaaccacagatttaggggataatgaggaccttttgatagaggggacactgcaggaaccagaagacctggaaagtgaaaccccaaattacctgaagtatgctgtactgcaccgagagaattacacttcaagtacaagctactgatgctgacccaactgccgtctactgcacctcacagaatatgaatcggtacaaaatttaagctgttttcgctcatctataaacagacgacactcccaaagaacccgagggacccctcccaagtgcgaatctgatgctcgccccgtatgctcacggcatgaagacttgcaccctgcctgttacaatgtaatatgcatgtgatgacatttgggaagtggagagagctgcccccttcccctgaccatcattcaacccatttgtccttcctttccacctcatatttttttaacccaagccaagagggtaatttatgaaaaagttttagaaaagggaataaaccctttccattgtccttctcatctcgtctcaagagctttccatctttggtactatatgtgaatgagtactgagtatatctatacactcttcaggccctcctgagctattacattggctgcctatcgacaaacagcaatagcagttaccctatgcctttgtaggagctttcccagaggccacagggcacagcacaatgtcggtagggtagactcggcaaggtttctgcttatcgtagggcatttctgcttagttttctctgaagcgaaagggctacatgtcaggtatacacagcatcattttgcagggatatactctcatttacagagggcgacaaagtgtatgtagatactcagtaccattatacaatgcagcatgttcttttttcagatggctaggcatttatagaggcactgagcaccattatacagtgcagcatgattattataaagctactggtagtgcatacaattattctgcattattatacagtgcagtgaattcattaagggggggggatcaaagtgtacagagatatttagtattgatacagagagcagcatgtttattattgggctgggagtgtatagagatactcaaaatcattatgcaggtgagcatgctcattttttagtgtacagagatgctcagcatcgtcatacactgtggcatggtcattatcaggggctggatgtgtatagagataatctgtataattatacagtaaagagtgttctttatgagggggtaggggaaaatggggattaaactgcccccctgactcaggaatttggatccagctttaggggggaatgatgagcattctgtatattaaggggattagcctaccccctccccactaaaatatccccagagtctccagccctactccagaaagagagaaagcactcacccacacaacctctccaatgctctttttagatgcaatttctgatatgcataagaaaatgattgtacaataattgctcatatgggaataaatactatgcaatataaaaaaaaaaaaaaaaaaaaaaaa
Translation: MWGFLTELGVCIVLIGFFVVSCQNVVHIVRGAGKFVLRRLHTELDKELGEGGGEDDEETLTTKVVRRRVIVKGNEVPDIPGEQVTEEEFTDEQGNIVTKKIVRKVLRRVGPPGTTDLGDNEDLLIEGTLQEPEDLESETPNYLKYAVLHRENYTSSTSY
Donor tissue: