ORFeome > MGC69188 – XORFeome 2.0

MGC69188 – XORFeome 2.0

General Information

Species: Xenopus tropicalis MGC69188 protein, mRNA (cDNA clone MGC:69188 IMAGE:5307217), complete cds
Gene Symbol: MGC69188
Gene ID: 448156
ORF gb_acc: MG133223
ORF ID: 10691

ORF full-length analysis tests

Clone type: Putative Full Length
XGC accession: BC074691

Library Location

Plate ID: GDExt11007
Well Location: G04

EST Sequences

Clone: MGC:69188 IMAGE:5307217
Trimmed Sequence: ATGTATCGCCTTTGCTCTGTTCTGTTGCTGCTGTGCCCAGTTTTGCAGGCACAGGAGATAAATGTCAACGAGAAGGTAACTGGCACCTTGGGGCAGCAAATAACTCTGCCCTGCACATTTAACAACAATGGTGTTGATATGCAAGTGACTCAGATAATGTGGATGAAAGATAGCACAAACCTTGCTACCTACAGCCCCCAGTTTGGCATCCATGTGCAGAACAAGAATGATTTCAATCTGACTGCCAGCCCAAGCAGTGCCACGCTCCTTATCAAGTTGCTGCGGGCTTCTGATGAAGGAAACTATATCTGTGAGGTCACCACCTTTCCAGGCGGCAACCGTAGGGGCATTACATATCTCAGTGTGAAAGCTGAACCAAGAAACTCAGCTGAAGCTCTTCCTGTAATTGCCGGCGACATAGAGGTTCCGGTGGCAAAATGTGCATCAGCCAATGGCAGGCCTCCATCCCAGATCACTTGGAGATCAACACTCCCAGGCAATTTTGATACCACTATGAATAATAACACAGATGGTACATACACGGTGGTCAGCAACTACAAGCTCGTCCCAACCTGGACTGCTGACAAGCAAGAAGTCATCTGCATTATTTCCTACGATTCCAAGGAGTCTGTGATTCCCATCACCCTGTCCATACAATACAGCCCAATTGTCACTATTGAAGGATACGATAACAACTGGTATCTGAAACGGCTCGGGGCCTCGCTTACCTGTAATGCTCACGGGAACCCCCAACCTACAGTATACACCTGGAAAACGGCCGACGGCTCGCCGCTCCCTAACACGGTGAAAGCTAAAGATAATGTGCTGTATGTGGATGAAGTGGACGAGCGAGTGAATACGACCATAGTCTGCGAGGTGACAAATGCCCTTGGGAGCCGAGCATCCCAACAGGAGGTGCTAGTGAGAGAACGTGCGCTCGAGAACCAGACAAACAACGCAGGAGCCATTGCCGGGGGTGTCATTGGGGGGGTCCTGGTCCTGCTCCTTCTAGCAGCCGTCATCTTCATCCTCATCCGGAGGGGAGGGGTGCACAAGAAAGAACGGGGATCCTACAACCCCAAACCCAGAATCTTCGGCAGCGGGAAACCCTCCCAGGAATTTACTTACCAGGACGACTCAGAGATGGGCAAACCTCTTAAAGCTTCTGGTCCATTGAGAGACAGTGGGTTGAGCCCTTCGCTGGCAGAGGAAGAGGAGGATGAATCCGAAGAGAGGATGAAATACAATGTTTTAGAGGACGACGACGAAGAAGAGAAATTCAACGAGGTGGGGCCCATGCTGCAACTTAGACCTCACCACGACCCCTACCTGGACGATGACATGGAGTCTCAGACTGACGGCTCTATCATCTCCAGGACTGCAGTGTATGTGTAA
Full Trace Sequence: gtgtgtgtggggctcagagtcagtgtgtgtgtggggctcggagcggagcaacacataccgggataggaggcttgggtgcccgcagtactgccgctgagacgcaaggccccccgggaaccgagctagagaaggagggaaggttgctaattggagccgcaggatgtatcgcctttgctctgttctgttgctgctgtgcccagttttgcaggcacaggagataaatgtcaacgagaaggtaactggcaccttggggcagcaaataactctgccctgcacatttaacaacaatggtgttgatatgcaagtgactcagataatgtggatgaaagatagcacaaaccttgctacctacagcccccagtttggcatccatgtgcagaacaagaatgatttcaatctgactgccagcccaagcagtgccacgctccttatcaagttgctgcgggcttctgatgaaggaaactatatctgtgaggtcaccacctttccaggcggcaaccgtaggggcattacatatctcagtgtgaaagctgaaccaagaaactcagctgaagctcttcctgtaattgccggcgacatagaggttccggtggcaaaatgtgcatcagccaatggcaggcctccatcccagatcacttggagatcaacactcccaggcaattttgataccactatgaataataacacagatggtacatacacggtggtcagcaactacaagctcgtcccaacctggactgctgacaagcaagaagtcatctgcattatttcctacgattccaaggagtctgtgattcccatcaccctgtccatacaatacagcccaattgtcactattgaaggatacgataacaactggtatctgaaacggctcggggcctcgcttacctgtaatgctcacgggaacccccaacctacagtatacacctggaaaacggccgacggctcgccgctccctaacacggtgaaagctaaagataatgtgctgtatgtggatgaagtggacgagcgagtgaatacgaccatagtctgcgaggtgacaaatgcccttgggagccgagcatcccaacaggaggtgctagtgagagaacgtgcgctcgagaaccagacaaacaacgcaggagccattgccgggggtgtcattgggggggtcctggtcctgctccttctagcagccgtcatcttcatcctcatccggaggggaggggtgcacaagaaagaacggggatcctacaaccccaaacccagaatcttcggcagcgggaaaccctcccaggaatttacttaccaggacgactcagagatgggcaaacctcttaaagcttctggtccattgagagacagtgggttgagcccttcgctggcagaggaagaggaggatgaatccgaagagaggatgaaatacaatgttttagaggacgacgacgaagaagagaaattcaacgaggtggggcccatgctgcaacttagacctcaccacgacccctacctggacgatgacatggagtctcagactgacggctctatcatctccaggactgcagtgtatgtgtaatgctccaccttgtaagcaccattgttatatccttccaccaccgagctcacactgaccgcaggccccaaacacatggactgcaatgtttccatctagcctcatcccaacaataatcaggattgctggtgtagatgtacaaactgttctcatccgcccaccatatggacttcattgtgcgtcctcactgcccttatatctacattctcctgacctgcagtgtgccactaccttgcatctcatagccgccggcctccacgctcctatttctaatggacacggcaaaaacaaatgtgctctttctttcttcaccaggagtgctatattcttctaatacccaatgttccttcttcccaccacccccaaaccacttggactttacaagggcagaatatgactctaacctgtgtcactgtgcatctcagggccctattgaggactggggactaaagaattggggcgactgtgcctcacactcacaggggaagggggttttattcgtcgggtaatggatggcatttttattttctctggactacaaagtgagtgtgcctcaggagataacatgaaggagggtgctcattgaaaacataaaaatgaagaattgactgataaagggttcatatgaagtagggagcagtgaataggaaacgttcctttccctaaaatttgttttttgtttttttattttatatatatttctgtaagataagaattttaataaaaaataattgtaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaa
Translation: MYRLCSVLLLLCPVLQAQEINVNEKVTGTLGQQITLPCTFNNNGVDMQVTQIMWMKDSTNLATYSPQFGIHVQNKNDFNLTASPSSATLLIKLLRASDEGNYICEVTTFPGGNRRGITYLSVKAEPRNSAEALPVIAGDIEVPVAKCASANGRPPSQITWRSTLPGNFDTTMNNNTDGTYTVVSNYKLVPTWTADKQEVICIISYDSKESVIPITLSIQYSPIVTIEGYDNNWYLKRLGASLTCNAHGNPQPTVYTWKTADGSPLPNTVKAKDNVLYVDEVDERVNTTIVCEVTNALGSRASQQEVLVRERALENQTNNAGAIAGGVIGGVLVLLLLAAVIFILIRRGGVHKKERGSYNPKPRIFGSGKPSQEFTYQDDSEMGKPLKASGPLRDSGLSPSLAEEEEDESEERMKYNVLEDDDEEEKFNEVGPMLQLRPHHDPYLDDDMESQTDGSIISRTAVYV
Donor tissue: gastrula