ORFeome > MGC69309 – XORFeome 2.0

MGC69309 – XORFeome 2.0

General Information

Species: Xenopus tropicalis MGC69309 protein, mRNA (cDNA clone MGC:69309 IMAGE:5308672), complete cds
Gene Symbol: MGC69309
Gene ID: 448108
ORF gb_acc: MG133187
ORF ID: 10650

ORF full-length analysis tests

Clone type: Putative Full Length
XGC accession: BC074639

Library Location

Plate ID: GDExt11006
Well Location: F11

EST Sequences

Clone: MGC:69309 IMAGE:5308672
Trimmed Sequence: ATGTCCCTCGGGTTCCTGGTGCTGTGGGTCGTTATGGACACTTTGAACGTTGCTGGGACCTTTCTTGCAGACCAGCTCCCCCTGCAGAAATATTTCTCCATTAACTGCATTCTCTGTGATTCCCTGCTGCTCGGCATCTACTGCTATTTCAGGCTTCGCAAATGGAGGCCCAGATCTCACACCCCCTTACATACAGTCTGTGGATTTGCCCTTCTGGGCTCTGTGGCCACTTTCTCTTTGCTTCAGGAGTCGGAACCCGCGGTGCAGAACCTCAGGGAAATGATACCCAGCCGGCGCCTACTCTCTGCTGATGGGGAGGAGGACGGTTCCATCAGGATGAAGATGGGTTACACCTTGGGGATCATCGTCTCGGGCATGTGGATCGTTTTTCGAATTCCTCAGATTGTCACCAACTTCAGGAGAAAATCAGTGGAAGGTTTGGCCCTGGGGATGTTCCTGCTCATGATGGTGGAAAACCTCTGCTTCGGGCTGAGTATTGTGCTGAAGAGCCCGCGGCAAAGCCAGACGGAGGCCAGTAAAGCTCTGCATCACTTGCCCTGGCTCATAGCCTGCGTGGGCTCAGTGGGCTCCGACTGGGTCCTCATGTACCAGTTTATCCGGTACCGGCCAAGGGCCCAGTGTGATGAAGAGGAGCCTCTTCTATTGTCCTCCGTCTCCCTTTACGGCTGA
Full Trace Sequence: ctgatattgatgaacctggagggctgagaagagaattgtgggaatttgtcctcctctgagacaatactatgaagcctgcaagacggggaagatgcaggaggcgatgtccctcgggttcctggtgctgtgggtcgttatggacactttgaacgttgctgggacctttcttgcagaccagctccccctgcagaaatatttctccattaactgcattctctgtgattccctgctgctcggcatctactgctatttcaggcttcgcaaatggaggcccagatctcacacccccttacatacagtctgtggatttgcccttctgggctctgtggccactttctctttgcttcaggagtcggaacccgcggtgcagaacctcagggaaatgatacccagccggcgcctactctctgctgatggggaggaggacggttccatcaggatgaagatgggttacaccttggggatcatcgtctcgggcatgtggatcgtttttcgaattcctcagattgtcaccaacttcaggagaaaatcagtggaaggtttggccctggggatgttcctgctcatgatggtggaaaacctctgcttcgggctgagtattgtgctgaagagcccgcggcaaagccagacggaggccagtaaagctctgcatcacttgccctggctcatagcctgcgtgggctcagtgggctccgactgggtcctcatgtaccagtttatccggtaccggccaagggcccagtgtgatgaagaggagcctcttctattgtcctccgtctccctttacggctgagaatgggaagaatcactgagaaaacgtctcgggttggacttttattcatttctagactgggagacgccatgtttgtgggcccagagctgccataggccaaggtgccatctgggcctgagagggttaataggagcagcgccagcaaagggcacagagcagactcactttattccaattgccccaaagcagctgttctgtggccttatgggtctgatcagctcagcggtgtgtggccctacagggaccagcggggcccgagcccgacaatatccctactggcagaacaaagatttttaacaaactctgaaactatgaaaattttattaaaaaaacagttttaaaagaattacacaggaatgaatggatattggggagttgtatcaggagtcagaaccagcagtgcagggaagggaaagggacagacacagtgacagttacacataactataaacccagtgagaatgagagatgaatggatattggggagttgtatcaggagtcagaaccagcagtgcagggaagggaaagggacagacacagtgacagttacacataactataaacccagtgagaatgaggaatgaatggatattggggagttgtatcaggagtcagaaccagcagtgcagggaagggaaagggacagacacagtgacagttacacataactataaacccagtgagaatgaggaatgaatggatattggggagttgtatcaggagtcagaaccagcagtgcagggaagggaaagggacagacacagtgacagttacacataactataaacccagtgagaatgaggaatgaatggatattggggagttgtatcaggagtcagaaccagcagtgcagggaagggaaagggacagacacagtgacagttacacataactataaacccagtgagaatgaggaatgaatggatattggggagttgtatcaggagtcagaaccagcagtgcagggaaggaaaagggacagacacagtgacagttacacataactataaacccagtgagaatgaggaatgaatggatattggggagttgtatcaggagtcagaaccagcagtgcagggaagggaaagggacagacacagtgacagttacacataactataaacccagtgagaatgaggaatgaatggatattggggagttgtatcaggagtcagaaccagcagtgcagggaagggaaagggacagacacagtgacagttacacataactataaacccagtgagaatgagggatgaatgggtattggggagttgtatcaggagtcagaaccagcagtgcagggaagggaaagggacagacacagtgacagttacacataactataaacccagtgagaatgaggaatgaatggatattggggagttgtatcaggagtcagaaccagcagtgcagggaagggaaagggacagacacagtgacagttacacataactataacatcttggtgacttatatccttatattttataacgggggtacattatttagtatataatagattcccaggccgagagagcaatcattctctttgaactaaggaggttccattttatagtgagacaaaccctacaagagcgacaagagcacaaatattggcctttgccagtcagtttctaaggttttatttgaataaacggagcattttgtacataaaaaaaaaaaaaaaaaaaa
Translation: MSLGFLVLWVVMDTLNVAGTFLADQLPLQKYFSINCILCDSLLLGIYCYFRLRKWRPRSHTPLHTVCGFALLGSVATFSLLQESEPAVQNLREMIPSRRLLSADGEEDGSIRMKMGYTLGIIVSGMWIVFRIPQIVTNFRRKSVEGLALGMFLLMMVENLCFGLSIVLKSPRQSQTEASKALHHLPWLIACVGSVGSDWVLMYQFIRYRPRAQCDEEEPLLLSSVSLYG
Donor tissue: gastrula