ORFeome > MGC69318 – XORFeome 2.0

MGC69318 – XORFeome 2.0

General Information

Species: Xenopus tropicalis hypothetical protein MGC69318, mRNA (cDNA clone MGC:69318 IMAGE:5308816), complete cds
Gene Symbol: MGC69318
Gene ID: 407906
ORF gb_acc: MG133182
ORF ID: 10645

ORF full-length analysis tests

Clone type: Putative Full Length
XGC accession: BC067924

Library Location

Plate ID: GDExt11006
Well Location: E07

EST Sequences

Clone: MGC:69318 IMAGE:5308816
Trimmed Sequence: ATGCAGACTGGCCTGTCCCTTGTTTGCCTTGTCCTCCTGTGCTCAGCACTGGGAGAGGCTGCCCTGAGAAAAACAAAGAAGCAGGCAGTAGTAACTGATACTGGTAACTCTGCCAAGTCTGATCCAGAGCCCGTACCAATAAAAACTAAAGGCCTCAAGACCCTGGACAGAGGCTGGGGAGAAGAGATTGAGTGGGTACAGACCTATGAAGAAGGACTGGCCAAGGCTAGAGAAAACAACAAACCTCTGATGGTGATTCACCACCTGGAAGATTGTCCTTACAGCATAGCTCTTAAAAAGGCATTTGTGGCTGACCGTCTGGCACAGAAACTTGCTCGGGAGGATTTTATAATGTTGAATCTGGTGCATCCAGTAGCAGATGAAAACCAGGCTCCAGATGGACACTACGTGCCAAGGGTCATCTTTGTTGATCCATCCCTGACTGTCCGATCAGACCTTAAAGGCAGATACGGAAACAAAATGTACGCCTATGATGCTGACGATATTCCTGAGTTGGTTACAAACATGAAGAAAGCCAAAAGTTACCTGAAAACTGAACTTTAA
Full Trace Sequence: ctatctgccacttgcagcactgtctccgaggagctgatctgaaactacctggataagcaacacatccatagacataatgcagactggcctgtcccttgtttgccttgtcctcctgtgctcagcactgggagaggctgccctgagaaaaacaaagaagcaggcagtagtaactgatactggtaactctgccaagtctgatccagagcccgtaccaataaaaactaaaggcctcaagaccctggacagaggctggggagaagagattgagtgggtacagacctatgaagaaggactggccaaggctagagaaaacaacaaacctctgatggtgattcaccacctggaagattgtccttacagcatagctcttaaaaaggcatttgtggctgaccgtctggcacagaaacttgctcgggaggattttataatgttgaatctggtgcatccagtagcagatgaaaaccaggctccagatggacactacgtgccaagggtcatctttgttgatccatccctgactgtccgatcagaccttaaaggcagatacggaaacaaaatgtacgcctatgatgctgacgatattcctgagttggttacaaacatgaagaaagccaaaagttacctgaaaactgaactttaagctgctgcacattgtgctccttctgatgctggagagatgaccacacagcactgaccagtctctccagccagagacacaacccccaaagtcagacatcagaatcccttgaaatatgaacatactgaatggaagagacaacatctggtgactgcacacctactcctattatccctgtcacggtactggttctggtgtcaccaaagctcacctatacattctgccattgtgtattcccaagcttggctcatatgttgccctatgtgaaagaaaacaaccaataatctatttttggcagcccacatatttttatgagggcttaatatgagcggactgcagtgcagcaatgccattcttggcttctttttcatactgcattataccagacctcccttctgtctctaaccatttatcttggtttgatctgctgttttttcatccagacctctgtcacacatctaattaacatatacatcaaaagcttgctcagactttccctgcaccttacaaagcctttaccttgtaaagccctatctttctgtatctcattgcatgcatataatagtgctaaactaagcctttgatttttttttcttgggttcatccagtatttctagtatttctagtatttccattggtttctccttgaactagactggtgctgttcagctttttatatgtagggattcatttctcatcccacatgttcaatggctgaattatactaaatgtcatacgcagaagtttttggagccctggattggtgtgggggccataaaaactctctggaggaccacttccatcctccagttggacagccctggaatactaaatctgttcttttgtatcagcgtatttaataagcagctctgttttccacatcctatatctttatgtctttctgtggcatacatcactcttatatagccaatgtttattctgtactgtgcagcaaggcctggtagtctgcgtgtagtcccaccttctcccaggtttaatcaaacagtgctctgcagtcttttcatatctagtccctattattaccctctaaaatcccacatacgagacatttcatcaattaatcctaattctactacaattaacctagcacatgcatttccaactccgtaatttcttatacgccaatgaagttttcaaggtggcgtcagtgatgcagctcggtttccatccactaagagatccatgctgcatttctataaaacaacattgatcagaaatctgatctaatgggcagccactgtcttcatatgcaatatcttccagttctgctgggtgacgttatacattttatagtaaatattttctgtgtatttttaagtagaattcataaaaatattttattcaaaaaaaaaaaaaaaaaaaaaa
Translation: MQTGLSLVCLVLLCSALGEAALRKTKKQAVVTDTGNSAKSDPEPVPIKTKGLKTLDRGWGEEIEWVQTYEEGLAKARENNKPLMVIHHLEDCPYSIALKKAFVADRLAQKLAREDFIMLNLVHPVADENQAPDGHYVPRVIFVDPSLTVRSDLKGRYGNKMYAYDADDIPELVTNMKKAKSYLKTEL
Donor tissue: gastrula