ORFeome > MGC69323 – XORFeome 2.0

MGC69323 – XORFeome 2.0

General Information

Species: Xenopus tropicalis MGC69323 protein, mRNA (cDNA clone MGC:69323 IMAGE:5308847), complete cds
Gene Symbol: MGC69323
Gene ID: 448074
ORF gb_acc: MG133333
ORF ID: 10833

ORF full-length analysis tests

Clone type: Putative Full Length
XGC accession: BC074600

Library Location

Plate ID: GDExt11008
Well Location: G02

EST Sequences

Clone: MGC:69323 IMAGE:5308847
Trimmed Sequence: ATGGAGAGAAGGGAATTCTGTGCCTCCCTGCTGGCCGGCGGCACGGCGGGAATGTGCGTGGATCTCATTTTATTTCCGCTCGACACCATCAAGACCAGGCTGCAGAGCCCACTTGGGTTTTCCAAATCCGGCGGATTCCGGGGTATATACGCCGGAGTCCCTTCGACCGCTGTAGGGTCATTTCCAAATGCTGCCGCCTTCTTCGTCACCTACGAATCTGCCAAACAGTTGCTTCGCTCCGACTCCTCTTACCTGTCCCCCATCATTCACATGGCGGCTGCCTCCCTAGGGGAAGTGGTGGCGTGTCTGATACGTGTTCCCTCTGAAGTCATAAAGCAAAGGGCGCAAGTGAGTCCGTCCTCCACCACCTATCAGATGTTATCCGCCACGCTACGGCAGGAGGGCATAAAGGGACTGTACCGAGGGTATAAGAGCACCGTGCTGAGAGAGATCCCATTCTCTTTGGTGCAGTTTCCACTGTGGGAGTCTTTAAAGGATCTCTGGTCGTGGAAGCAAGGCCGCGCGGTTGATTCTTGGCAGTCAGCAGTGTGTGGAGCTTTTGCAGGTGGCTTTGCAGCTGCGCTCACCACTCCTCTGGACGTAGCGAAAACACGAATCATGTTGGCGAAGGCCGGTTCTGGTGTCGCAAGTGGAAATGTTCTATTCGCTCTACATGAGATTTGGAGAACGCAAGGCATCATGGGGTTATTTGCCGGAGTTATTCCCAGAATGACAGCAATCAGTCTCGGTGGATTCATTTTCCTTGGAGCCTACGACAAAGTCCGGACGTTGATGCTACGAGAGCAGTGA
Full Trace Sequence: ggctgaatccagtgtcactactaactggtgactttgtagcagtggagagagcatgctggggtagcgttacggggcacttggagggggggatgcggcactaaaattcggactatggagagaagggaattctgtgcctccctgctggccggcggcacggcgggaatgtgcgtggatctcattttatttccgctcgacaccatcaagaccaggctgcagagcccacttgggttttccaaatccggcggattccggggtatatacgccggagtcccttcgaccgctgtagggtcatttccaaatgctgccgccttcttcgtcacctacgaatctgccaaacagttgcttcgctccgactcctcttacctgtcccccatcattcacatggcggctgcctccctaggggaagtggtggcgtgtctgatacgtgttccctctgaagtcataaagcaaagggcgcaagtgagtccgtcctccaccacctatcagatgttatccgccacgctacggcaggagggcataaagggactgtaccgagggtataagagcaccgtgctgagagagatcccattctctttggtgcagtttccactgtgggagtctttaaaggatctctggtcgtggaagcaaggccgcgcggttgattcttggcagtcagcagtgtgtggagcttttgcaggtggctttgcagctgcgctcaccactcctctggacgtagcgaaaacacgaatcatgttggcgaaggccggttctggtgtcgcaagtggaaatgttctattcgctctacatgagatttggagaacgcaaggcatcatggggttatttgccggagttattcccagaatgacagcaatcagtctcggtggattcattttccttggagcctacgacaaagtccggacgttgatgctacgagagcagtgaagggaattcccttgacactcagtaactttagttggagcccccgtggcccccagagaccccccaacactgggatattgcagcacaaagtgtagtttcatatgggggaaatgtcagcgctggaaacaactccccgcgggtcaaaagagacgggaaaccgactgcgtttgtacaaaatggcgatgtccaaaccccacggataaacagaaacatcagagacaatttatttctctacattttttatttttttaaccagaacctcgggttcttccacaaaatgttgtgctgttataacaaacgtttagtaaagacacaatcaatgccatttgttagaaacttcagtattttgcaggtttggttcctcccaatgtacaactttgtatcaataaataactttgtacacaaaaacaaaaaaaaaaaaaaa
Translation: MERREFCASLLAGGTAGMCVDLILFPLDTIKTRLQSPLGFSKSGGFRGIYAGVPSTAVGSFPNAAAFFVTYESAKQLLRSDSSYLSPIIHMAAASLGEVVACLIRVPSEVIKQRAQVSPSSTTYQMLSATLRQEGIKGLYRGYKSTVLREIPFSLVQFPLWESLKDLWSWKQGRAVDSWQSAVCGAFAGGFAAALTTPLDVAKTRIMLAKAGSGVASGNVLFALHEIWRTQGIMGLFAGVIPRMTAISLGGFIFLGAYDKVRTLMLREQ
Donor tissue: gastrula