ORFeome > MGC75626 – XORFeome 2.0

MGC75626 – XORFeome 2.0

General Information

Species: Xenopus tropicalis hypothetical protein MGC75626, mRNA (cDNA clone MGC:75626 IMAGE:5379393), complete cds
Gene Symbol: MGC75626
Gene ID: 395036
ORF gb_acc: MG132824
ORF ID: 10172

ORF full-length analysis tests

Clone type: Full Length
XGC accession: BC064860

Library Location

Plate ID: GDExt11003
Well Location: A01

EST Sequences

Clone: MGC:75626 IMAGE:5379393
Trimmed Sequence: ATGAGTCAGACGGAGAAGATTGAAGAAGCTGTCCCTTCATACCTGTGCGAGGAGCCACCAGAGGGTACCGTCAAAGACCACCCTCAACAGCAGCCTGGCATGATTTCCCGTGTAACAGGTGGCATCTTCAGCATGACCAAAGGGGCTGTCGGTGCCACTATTGGAGGAGTCGCTTGGATTGGAGGAAAGAGTTATGAAGTGACCAAGACAGCGGTGACGTCGGTGCCGAGTATAGGCGTCGGCATCGTCAAAGGCAGCGTGTCTGCTGTCACCGGAAGCGTGGCAGCTGTGGGATCGGTTGTTTCCAGTAAAGTGTCAGGAAAAAAGAAGGACAAGTCCGACTGA
Full Trace Sequence: cggagagacggcgggagggaagctcggaattgtgcgggcatcttcctgtgcctggtcctgggggctgctcagtatctgctggctgaggtagaaagctctgtgtgcaggcataatgagtcagacggagaagattgaagaagctgtcccttcatacctgtgcgaggagccaccagagggtaccgtcaaagaccaccctcaacagcagcctggcatgatttcccgtgtaacaggtggcatcttcagcatgaccaaaggggctgtcggtgccactattggaggagtcgcttggattggaggaaagagttatgaagtgaccaagacagcggtgacgtcggtgccgagtataggcgtcggcatcgtcaaaggcagcgtgtctgctgtcaccggaagcgtggcagctgtgggatcggttgtttccagtaaagtgtcaggaaaaaagaaggacaagtccgactgagccaagaactcctcattgtgagaactattgcaggcgtgactgggcatccgctgcaaaaatgagtgaccgctgcagcatcgaagacattttattattctttcatttttttgttttgtttttgggtcgggttgcggcggtacttgtgagctagccaatggtgtcgcagcaggcgtacaatgccctcaggctatgaaggctgattgaaacggcaatgcaaaatgttacattctatgactcctaaaccaaaatcatgtgcgcaaattttcagccagctgcgactttcccgggacctgtgtttgctttcctagagaaaaagaacctcactacttggtttggcagtgtaaccagtgggatgatgctagcgtagcccagaatagcacagtgatcgcattctagatcctcaccagagagacacaagaaaaactccaattaatgcaatgcaattctgtaggggaggaaggactctgagctgcatttttacaaggatttaatttgtattttttacttgtccaggatttcaaccctttagtccctgcctccaccttgagacaaaaaagtgcatatttatgtttattatacaataaaaattatgcttggtttttgcaatagatattgacactgtctatcattgtgggattccatttgtttcatttatttatattttcttgccctttatttgtatgatctaaggcaagagtaaaactcatctgtgggcagttcacaactcctagccgagggaagctgggaattgtagtccaacacagtttgtttcacacgtttgttagtctgttttccattaattcagttgttcttctgcacatcttagtgccttgtagattaggaggttcctattcacaggtaagcttcctgatgtatatcctatattgttctctgacaatatgtatgctgctttaaagggcaaggataagaaaagcctagatttacccatgtaaggccgcaactgccaaccagatgtctctctccccccccccccccccattcacaggtttccattatttaaactgctcattagttcctaaggcagtgtggccctaacaaccagataacagatataggtaaggggcccagtgcagacgcggataagaaaagcacagctaatggaatttttggacagttgctccactgacgtgaaattctgttcacatctgggagaacatttttatctctctacacaggtcaatactgctaatgccccctacttatagccccccccccccctttagattgtcatgtgcaacacacctaggtcagctcttccccaaaactttttcaggggtgtgtttatcagctccattgtttcaatagcagaagtgctgaaaatctaaacagatgcctctccaaaaaccttactcacaataaataaatgctagaaggaggtttagaatgatatgttcactaggcaaagcatcattttgggctgttacacctgctttaaagtgatctgcctttcagcacagctattatttattctgggctttatataccctttaatatcccctcttccatctgtatgtaagagatcaactttattttccctttaagttcctgtttctttatgcgacccctttactttgtatgcttgtggctctttatttcagtatattgctttgtgtgtgtctcacagctaattagcagatcctcaatgtgcagagtacagttataccccccctaatatatacgcctttcagatatgtgcagatctagtcgaccacttgaactgtgaattgtggtgtgatgacatttttgtgcctgaatagatttaataaaatatatcttctactgtaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaa
Translation: MSQTEKIEEAVPSYLCEEPPEGTVKDHPQQQPGMISRVTGGIFSMTKGAVGATIGGVAWIGGKSYEVTKTAVTSVPSIGVGIVKGSVSAVTGSVAAVGSVVSSKVSGKKKDKSD
Donor tissue: tailbud