ORFeome > MGC75663 – XORFeome 2.0

MGC75663 – XORFeome 2.0

General Information

Species: Xenopus tropicalis hypothetical protein MGC75663, mRNA (cDNA clone MGC:75663 IMAGE:5379861), complete cds
Gene Symbol: MGC75663
Gene ID: 394906
ORF gb_acc: MG132830
ORF ID: 10179

ORF full-length analysis tests

Clone type: Full Length
XGC accession: BC064179

Library Location

Plate ID: GDExt11002
Well Location: B09

EST Sequences

Clone: MGC:75663 IMAGE:5379861
Trimmed Sequence: ATGTCTATTCTGAGGCGAAGTAGAAATATCATTCATGCTGTGCGCCTTGCAGGCACATCTGCCAGTGTTCAGGCAGCTCCAGGGTTTGAAGTGGACACAGAAGAAAATGAACTTGTTAACCCAAATTTTGTCAATAGAAACCCACGTAATATGGAATGCTTAGCATTGGCAGTAAAAGACAGAGGATGGGGTACAGTGTGGCCAACTCGACAATACTGGCATAGATTGCGTTTTGAACGATCTCAGCACCATGTCTCTGCATTTGTGGAGCATTCCAATGGAAACGTGATAGTCTCGGCTTCTACCCGTGAGTGGGCAGTGAAGAGGCACCTTTACAGCACAAAGGATGTCATGGCTTGTGAAAACATTGGCCGTGTACTAGCTCAGCGCTGTTTAGAGGCTGGAATCAGTTATATGATATTTCGTGAGATCCCCTGGACCTTCCGATCTGAAGCGGTGCAGCGTTTTCGAAATGCAATGAAGGAAGGTGGCGTTGTTTTAAGTGAACCACGTCGAATTTATGAGTGA
Full Trace Sequence: gccctgttctgttcctgtgtcctatgtatggcagttctgctgctgttaggggactcgcatgtagtagaaccttagtggagatataagtacaaaatccgttttccatagatgcactgatgtctattctgaggcgaagtagaaatatcattcatgctgtgcgccttgcaggcacatctgccagtgttcaggcagctccagggtttgaagtggacacagaagaaaatgaacttgttaacccaaattttgtcaatagaaacccacgtaatatggaatgcttagcattggcagtaaaagacagaggatggggtacagtgtggccaactcgacaatactggcatagattgcgttttgaacgatctcagcaccatgtctctgcatttgtggagcattccaatggaaacgtgatagtctcggcttctacccgtgagtgggcagtgaagaggcacctttacagcacaaaggatgtcatggcttgtgaaaacattggccgtgtactagctcagcgctgtttagaggctggaatcagttatatgatatttcgtgagatcccctggaccttccgatctgaagcggtgcagcgttttcgaaatgcaatgaaggaaggtggcgttgttttaagtgaaccacgtcgaatttatgagtgactggtggaatagattcagcaggctttcctttattttaagaacattagtgatttatttaatacttggaactgtatcacaatattttttgttctgttgctaatgagaaaaaagccaccctctgagttgtacattaaattcagttattgcagtttctccaaagaattactgtatgttgttaattgttaatgcatttttatatcataaatacctaataaatctttaaaaatggcaacatatttaatgtgctgagttttttaagaagctaaattacattaataacatgaaatcaaatttatttttttttaaataaaattctcagtgtatgttttggcccttgaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaa
Translation: MSILRRSRNIIHAVRLAGTSASVQAAPGFEVDTEENELVNPNFVNRNPRNMECLALAVKDRGWGTVWPTRQYWHRLRFERSQHHVSAFVEHSNGNVIVSASTREWAVKRHLYSTKDVMACENIGRVLAQRCLEAGISYMIFREIPWTFRSEAVQRFRNAMKEGGVVLSEPRRIYE
Donor tissue: tadpole