ORFeome > MGC75681 – XORFeome 2.0

MGC75681 – XORFeome 2.0

General Information

Species: Xenopus tropicalis ribosomal protein L13, mRNA (cDNA clone MGC:75681 IMAGE:5380148), complete cds
Gene Symbol: MGC75681
Gene ID: 394716
ORF gb_acc: MG132860
ORF ID: 10214

ORF full-length analysis tests

Clone type: Full Length
XGC accession: BC062495

Library Location

Plate ID: GDExt11002
Well Location: E08

EST Sequences

Clone: MGC:75681 IMAGE:5380148
Trimmed Sequence: ATGGCCCCCAGCCGGAATGGCATGATCTTGAAGCCTCACTTTCACAAGGACTGGCAGAGACGGGTAGCTACCTGGTTTAACCAGCCTGCTAGAAAGATCCGCAGACGTAAGGCACGCCAGGTCAAAGCACGGTTGGTTGCCCCAAGGCCTGTTTCAGGTCCAGTCAGACCAGTGGTAAAATGCCCTACTATCAGATACCACACAAAGGTGCGAATGGGCAGAGGCTTCAGCCTAGAAGAGTTAAAGGCTGCTGGTATCAACAAGAAAGTTGCCCGCACCATTGGCATTTCTGTTGACCCAAGACGCCGCAACAGATCTACAGAGGGCTTGCAAACAAATGTCCAGAGGCTGAAAGAGTACCGCTCCAAACTAATCATCTTCCCACGCAAACCTGCTGCACCCAAGAAGGGAGACAGCTCGGCTGAAGAGTTGAAACTGGCTACTCAGTTGAAGGGACCAGTCATGCCAATCCGCAGTGTGTACAAGAAAGAGAAGCCCAGAGTCATCACTGAAGAGGAGAAGAACTTCAAAGCCTTTGCAAGTCTGCGTATGGCACGTGCTAATGCCCGGCTCTTTGGCATCCGTGCCAAGAAAGCCAAAGAGGCTGCAGAACAGGATGTTGAGAAGAAGAAATAA
Full Trace Sequence: ttttctccccgtagagggattaagtagccatggcccccagccggaatggcatgatcttgaagcctcactttcacaaggactggcagagacgggtagctacctggtttaaccagcctgctagaaagatccgcagacgtaaggcacgccaggtcaaagcacggttggttgccccaaggcctgtttcaggtccagtcagaccagtggtaaaatgccctactatcagataccacacaaaggtgcgaatgggcagaggcttcagcctagaagagttaaaggctgctggtatcaacaagaaagttgcccgcaccattggcatttctgttgacccaagacgccgcaacagatctacagagggcttgcaaacaaatgtccagaggctgaaagagtaccgctccaaactaatcatcttcccacgcaaacctgctgcacccaagaagggagacagctcggctgaagagttgaaactggctactcagttgaagggaccagtcatgccaatccgcagtgtgtacaagaaagagaagcccagagtcatcactgaagaggagaagaacttcaaagcctttgcaagtctgcgtatggcacgtgctaatgcccggctctttggcatccgtgccaagaaagccaaagaggctgcagaacaggatgttgagaagaagaaataagttttccagaactgttaataaattcgaaacttggtgtaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaa
Translation: MAPSRNGMILKPHFHKDWQRRVATWFNQPARKIRRRKARQVKARLVAPRPVSGPVRPVVKCPTIRYHTKVRMGRGFSLEELKAAGINKKVARTIGISVDPRRRNRSTEGLQTNVQRLKEYRSKLIIFPRKPAAPKKGDSSAEELKLATQLKGPVMPIRSVYKKEKPRVITEEEKNFKAFASLRMARANARLFGIRAKKAKEAAEQDVEKKK
Donor tissue: tadpole