ORFeome > MGC75697 – XORFeome 2.0

MGC75697 – XORFeome 2.0

General Information

Species: Xenopus tropicalis hypothetical protein MGC75697, mRNA (cDNA clone MGC:75697 IMAGE:5380497), complete cds
Gene Symbol: MGC75697
Gene ID: 394673
ORF gb_acc: MG132952
ORF ID: 10328

ORF full-length analysis tests

Clone type: Full Length
XGC accession: BC061264

Library Location

Plate ID: GDExt11004
Well Location: A01

EST Sequences

Clone: MGC:75697 IMAGE:5380497
Trimmed Sequence: ATGTGTGACGACGATGAGACCACCGCTTTGGTGTGCGATAACGGTTCTGGGCTAGTGAAAGCTGGCTTTGCCGGAGATGATGCTCCCCGTGCTGTCTTCCCCTCAATTGTGGGACGTCCTCGTCACCAGGGTGTCATGGTTGGTATGGGCCAAAAGGACTCCTATGTTGGGGATGAAGCCCAGAGCAAGAGGGGTATTCTGACCCTCAAGTACCCAATTGAGCATGGTATCATCACCAACTGGGATGACATGGAAAAGATCTGGCATCACACCTTTTACAATGAGTTGCGTGTGGCCCCAGAGGAACACCCCACCCTGCTCACAGAGGCACCTCTTAACCCCAAAGCCAACCGTGAAAAAATGACACAGATCATGTTTGAGACCTTCAATGTTCCAGCAATGTATGTAGCCATCCAGGCCGTTCTGTCCTTATACGCATCTGGACGTACCACTGGTATCGTCTTGGACTCTGGTGATGGTGTGACCCACAACGTGCCAATTTATGAAGGTTATGCTTTGCCCCATGCCATCCAGCGTCTGGACCTTGCCGGACGTGACCTGACTGACTACCTCATGAAGATCCTGACTGAGAGAGGCTACTCTTTTGTCACAACAGCTGAAAGGGAGATTGTGAGGGACATTAAGGAGAAGCTTGCCTATGTGGCTCTGGACTTTGAAAATGAGATGGCAACAGCAGCCACTTCCTCATCTTTGGAGAAGAGCTATGAACTCCCAGACGGACAGGTCATTACCATTGGAAATGAAAGGTTCCGTTGCCCAGAAACACTCTTCCAGCCATCCTTCATTGGTATGGAGTCTGCAGGTATCCATGAGACCACTTACAACTCCATCATGAAGTGCGACATTGACATCCGTAAGGACCTCTATGCCAACAATGTTTTGTCTGGTGGTACCACCATGTACCCTGGTATTGCTGACCGTATGCAGAAGGAAATCACAGCCCTTGCTCCAAGCACAATGAAGATCAAGATTATTGCTCCTCCAGAACGTAAATACTCTGTATGGATTGGAGGTTCCATCCTTGCCTCTCTCTCCACCTTCCAACAGATGTGGATCAGCAAGCAGGAATATGATGAAGCCGGCCCCTCAATTGTGCACAGAAAGTGCTTCTAA
Full Trace Sequence: ctactcctactctctccctgctgcaaaagtctcagtccctctccagactcaaacatgtgtgacgacgatgagaccaccgctttggtgtgcgataacggttctgggctagtgaaagctggctttgccggagatgatgctccccgtgctgtcttcccctcaattgtgggacgtcctcgtcaccagggtgtcatggttggtatgggccaaaaggactcctatgttggggatgaagcccagagcaagaggggtattctgaccctcaagtacccaattgagcatggtatcatcaccaactgggatgacatggaaaagatctggcatcacaccttttacaatgagttgcgtgtggccccagaggaacaccccaccctgctcacagaggcacctcttaaccccaaagccaaccgtgaaaaaatgacacagatcatgtttgagaccttcaatgttccagcaatgtatgtagccatccaggccgttctgtccttatacgcatctggacgtaccactggtatcgtcttggactctggtgatggtgtgacccacaacgtgccaatttatgaaggttatgctttgccccatgccatccagcgtctggaccttgccggacgtgacctgactgactacctcatgaagatcctgactgagagaggctactcttttgtcacaacagctgaaagggagattgtgagggacattaaggagaagcttgcctatgtggctctggactttgaaaatgagatggcaacagcagccacttcctcatctttggagaagagctatgaactcccagacggacaggtcattaccattggaaatgaaaggttccgttgcccagaaacactcttccagccatccttcattggtatggagtctgcaggtatccatgagaccacttacaactccatcatgaagtgcgacattgacatccgtaaggacctctatgccaacaatgttttgtctggtggtaccaccatgtaccctggtattgctgaccgtatgcagaaggaaatcacagcccttgctccaagcacaatgaagatcaagattattgctcctccagaacgtaaatactctgtatggattggaggttccatccttgcctctctctccaccttccaacagatgtggatcagcaagcaggaatatgatgaagccggcccctcaattgtgcacagaaagtgcttctaattatattcttaccccaattcctctgtgtacaaatgtcacaaatatatacaaaattacaataaaacatttgttataaacaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaa
Translation: MCDDDETTALVCDNGSGLVKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIITNWDDMEKIWHHTFYNELRVAPEEHPTLLTEAPLNPKANREKMTQIMFETFNVPAMYVAIQAVLSLYASGRTTGIVLDSGDGVTHNVPIYEGYALPHAIQRLDLAGRDLTDYLMKILTERGYSFVTTAEREIVRDIKEKLAYVALDFENEMATAATSSSLEKSYELPDGQVITIGNERFRCPETLFQPSFIGMESAGIHETTYNSIMKCDIDIRKDLYANNVLSGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDEAGPSIVHRKCF
Donor tissue: tadpole