ORFeome > MGC75699 – XORFeome 2.0

MGC75699 – XORFeome 2.0

General Information

Species: Xenopus tropicalis ribosomal protein S3, mRNA (cDNA clone MGC:75699 IMAGE:5380544), complete cds
Gene Symbol: MGC75699
Gene ID: 394724
ORF gb_acc: MG132974
ORF ID: 10352

ORF full-length analysis tests

Clone type: Full Length
XGC accession: BC061265

Library Location

Plate ID: GDExt11004
Well Location: C01

EST Sequences

Clone: MGC:75699 IMAGE:5380544
Trimmed Sequence: ATGGCGGTGCAGATCTCTAAGAAGAGGAAGTTTGTCGCTGACGGCATCTTCAAGGCTGAACTCAATGAGTTCCTTACTCGGGAGCTGGCTGAAGATGGCTACTCCGGTGTAGAGGTCAGAGTCACCCCAACCCGGACTGAAATCATCATTCTCGCTACCAGAACCCAAAATGTTCTGGGTGAGAAGGGCAGGCGCATCCGTGAGCTGACTGCAGTTGTTCAGAAGAGGTTTGGATTCCCTGAAGGGAGTGTTGAGCTCTATGCTGAGAAAGTTGCCACAAGGGGTCTGTGTGCCATTGCCCAAGCCGAATCTCTCCGTTACAAACTCCTGGGAGGTCTGGCTGTGAGGAGAGCTTGCTATGGTGTCCTCCGTTTCATCATGGAGAGTGGAGCCAAGGGTTGTGAGGTTGTCGTGTCCGGAAAACTAAGAGGCCAGAGAGCCAAGTCCATGAAGTTCGTAGACGGCCTGATGATCCACAGTGGAGATCCAGTTAATTACTACGTGGATACTGCTGTACGCCATGTGCTCCTCAGGCAGGGTGTCCTTGGAATCAAGGTAAAGATTATGCTTCCCTGGGATCCAAGTGGAAAGATCGGACCCAAGAAGCCCCTGCCTGACCACGTCAGCATTGTTGAACCCAAGGAAGAGATTCTGCCTACAACCCCCATCTCTGAGCAGAAGGGAGCCAAGCCAGATCAGCCACAACCACCCGCCATGCCACAGCCTGTGCCCACAGCATAA
Full Trace Sequence: gtggcctccctttccttccagcggcgcttcgcaagatggcggtgcagatctctaagaagaggaagtttgtcgctgacggcatcttcaaggctgaactcaatgagttccttactcgggagctggctgaagatggctactccggtgtagaggtcagagtcaccccaacccggactgaaatcatcattctcgctaccagaacccaaaatgttctgggtgagaagggcaggcgcatccgtgagctgactgcagttgttcagaagaggtttggattccctgaagggagtgttgagctctatgctgagaaagttgccacaaggggtctgtgtgccattgcccaagccgaatctctccgttacaaactcctgggaggtctggctgtgaggagagcttgctatggtgtcctccgtttcatcatggagagtggagccaagggttgtgaggttgtcgtgtccggaaaactaagaggccagagagccaagtccatgaagttcgtagacggcctgatgatccacagtggagatccagttaattactacgtggatactgctgtacgccatgtgctcctcaggcagggtgtccttggaatcaaggtaaagattatgcttccctgggatccaagtggaaagatcggacccaagaagcccctgcctgaccacgtcagcattgttgaacccaaggaagagattctgcctacaacccccatctctgagcagaagggagccaagccagatcagccacaaccacccgccatgccacagcctgtgcccacagcataataggctgaagtcctggattcaaagattttggatacagtatcagaacatctaaaataaaaaaaattaaaatccaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaa
Translation: MAVQISKKRKFVADGIFKAELNEFLTRELAEDGYSGVEVRVTPTRTEIIILATRTQNVLGEKGRRIRELTAVVQKRFGFPEGSVELYAEKVATRGLCAIAQAESLRYKLLGGLAVRRACYGVLRFIMESGAKGCEVVVSGKLRGQRAKSMKFVDGLMIHSGDPVNYYVDTAVRHVLLRQGVLGIKVKIMLPWDPSGKIGPKKPLPDHVSIVEPKEEILPTTPISEQKGAKPDQPQPPAMPQPVPTA
Donor tissue: tadpole