ORFeome > MGC75714 – XORFeome 2.0

MGC75714 – XORFeome 2.0

General Information

Species: Xenopus tropicalis hypothetical protein MGC75714, mRNA (cDNA clone MGC:75714 IMAGE:5380755), complete cds
Gene Symbol: MGC75714
Gene ID: 394598
ORF gb_acc: MG132961
ORF ID: 10337

ORF full-length analysis tests

Clone type: Full Length
XGC accession: BC061274

Library Location

Plate ID: GDExt11003
Well Location: B10

EST Sequences

Clone: MGC:75714 IMAGE:5380755
Trimmed Sequence: ATGGCCGCCAAGGACTACGACCATCTTTTTAAACTGCTTCTCATTGGAGACTCTGGTGTTGGAAAAAGCAGCCTCTTGCTGAGATTCTCCGATAACTCCTTCTCTGGAAGTTACATCACAACCATTGGGGTCGACTTCAAGATCCGGACTCTGGTTCTGGACGGAGAGCGAGTGAAGCTGCAGATCTGGGACACGGCCGGACAGGAGCGATTTAGGACAATCACCTCCACGTATTACAGGAACACCCACGGCGTTATTGTGGTTTATGATGTCACCAGCCCAGAATCCTTTGTGAATGTGAAGCGATGGCTGCACGAGATCACCCAGAATTGCGACTCCGTCTGCACCGTACTGGTCGGTAACAAAGACGACGATCCGTCCCGGAAACGCGTGGAAGCCGCCGACGCCAAGAGGTTTGCCGATCAGATGGGAGTCAGAATGTTTGAGACGAGTGCAAAAGAGAACCGCAACGTGGAGGAGATGTTCCTTTCTGTGACCCGTATGGTCCTGCGCATGAAGAAAGACAACCAGGCCAGGCTGAATCCCAGCGAGGTGGTCACCATCACCAAGACTAAGAAGAAACCGCACGTCAAGAGATGCTGCTGA
Full Trace Sequence: agtgtgagagtgtaaatatcacacaggttggacagttctcacaagtggtgccatggataaggggcacgagtaagagtttaacggacacagaagaaaaagtggcatttggaactccagagagcacagaaaggagactgcacgggcacaagtgaggaagataagtgccccgactgctgacgtataaaatggccgccaaggactacgaccatctttttaaactgcttctcattggagactctggtgttggaaaaagcagcctcttgctgagattctccgataactccttctctggaagttacatcacaaccattggggtcgacttcaagatccggactctggttctggacggagagcgagtgaagctgcagatctgggacacggccggacaggagcgatttaggacaatcacctccacgtattacaggaacacccacggcgttattgtggtttatgatgtcaccagcccagaatcctttgtgaatgtgaagcgatggctgcacgagatcacccagaattgcgactccgtctgcaccgtactggtcggtaacaaagacgacgatccgtcccggaaacgcgtggaagccgccgacgccaagaggtttgccgatcagatgggagtcagaatgtttgagacgagtgcaaaagagaaccgcaacgtggaggagatgttcctttctgtgacccgtatggtcctgcgcatgaagaaagacaaccaggccaggctgaatcccagcgaggtggtcaccatcaccaagactaagaagaaaccgcacgtcaagagatgctgctgactccgccccttggatgtgtcagggcaccttctactaaattaactggaaatggactatgggagtttgggggggaagggatgactagtaggaagggctgctgtgcaagctggatcgtaccactgtttgggggacacatgatagctgaaaggggtgttttgttgtgcaacatggctgtgtatgtgagtcttgatctaagttccattcagccatagcaggggggctactgtacttggtagacatatcgtggcagctctacggagtcagaactggaataagaactgttccgtaaaacgggctggaggttaagggaaaagccataagtgtgggccaaccacaaaactggcagctcagtgccatcgagcaaacgtatcatccactacggtggccttcctgtccccacactgagaagctgtaggcttgttcccagtactagtagggtcatctgctgagcaatggattgaacaggaatagaagagatgagggcaccacaaagtaaggagaagtttggaatctgtaagaccactagggagtgctgcagtgtagggtggatgtacaggcagagtatgtgagaagaagagcagggtagtttaggtacagtagttgcaggtgagaccactgaatcatttgccccacagtgttacttaggtatgtttaataactgacggcagcagccatatttaatgtggttggggtggccatctttaatgcattccctctctccatcttataaaagcctctcactactgtatatctatatatttatgtattccctttctcccgagctgtacatgaatttaaagcttatttttgcatttaactggatattaacttggagattataaactggacttttttctaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaa
Translation: MAAKDYDHLFKLLLIGDSGVGKSSLLLRFSDNSFSGSYITTIGVDFKIRTLVLDGERVKLQIWDTAGQERFRTITSTYYRNTHGVIVVYDVTSPESFVNVKRWLHEITQNCDSVCTVLVGNKDDDPSRKRVEAADAKRFADQMGVRMFETSAKENRNVEEMFLSVTRMVLRMKKDNQARLNPSEVVTITKTKKKPHVKRCC
Donor tissue: tadpole