ORFeome > MGC75766 – XORFeome 2.0

MGC75766 – XORFeome 2.0

General Information

Species: Xenopus tropicalis ATP synthase subunit B, mRNA (cDNA clone MGC:75766 IMAGE:5381797), complete cds
Gene Symbol: MGC75766
Gene ID: 394723
ORF gb_acc: MG132931
ORF ID: 10298

ORF full-length analysis tests

Clone type: Full Length
XGC accession: BC061296

Library Location

Plate ID: GDExt11003
Well Location: B07

EST Sequences

Clone: MGC:75766 IMAGE:5381797
Trimmed Sequence: ATGCTATCCAGAGCCGCTCTGACCTCAGCCTCTGCCCTGAGGAAAACTGCCCCTCTCAGCGTTGGACTTCTGAACCAATGCAGGTCATTTCACAAGGGGCAGCCTGCCATGGCTCCAGTGCCCCCACTTCCAGAGAAAGGAGGAAAGGTCCGTTTTGGTCTGATCCCTGAAGAGTTCTTCCAATTCCTTTACCCCAAGACAGGAGTCACAGGCCCTTACATGCTGGGCACTGGTCTCCTTGTTTACCTTTTGTCAAAGGAAATATATGTCATTAATCATGAGACTTTTGCTGCTGCCTCTATTGGTATTGTCATCGTTTATGGAATCAAGAAATTTGGGCCCAGCGTGGCAGCCTTTGCTGACAAGCTCAATGAAGAGAAAGTTGCTAAGGCTCAGGCAGTGAAAGACTCTGCACTTAAGAATCTGGAGCGGGCTATTGAAGAAGAAAACAAGGAACAGTGGAGGGTTGAAGGAAGGCACCACCTGTTTGATGCAAAAAGGAACAATGTGACGATGCTTCTGGAAATTAACTACAGAGAGAGAATTCTGAATGTTTATAACGAGGTTAAAAAGCGTTTGGATTATCAGGTAGCTCTGCAACATCTCCAGCGTCGCAAGGAGCAGGATCATATGATCAACTGGGTAGAAAAAAATGTAATACAGAGTATTACCCCCCAACAGCAAAAGGAGAGCATTGCCAAATGTATCACAGACCTGAAAGTTCTATCCAAGACTGCACAAGCAAGTGTTTAA
Full Trace Sequence: ccggtctcaaagaggcattttccccgctgcaccatgctatccagagccgctctgacctcagcctctgccctgaggaaaactgcccctctcagcgttggacttctgaaccaatgcaggtcatttcacaaggggcagcctgccatggctccagtgcccccacttccagagaaaggaggaaaggtccgttttggtctgatccctgaagagttcttccaattcctttaccccaagacaggagtcacaggcccttacatgctgggcactggtctccttgtttaccttttgtcaaaggaaatatatgtcattaatcatgagacttttgctgctgcctctattggtattgtcatcgtttatggaatcaagaaatttgggcccagcgtggcagcctttgctgacaagctcaatgaagagaaagttgctaaggctcaggcagtgaaagactctgcacttaagaatctggagcgggctattgaagaagaaaacaaggaacagtggagggttgaaggaaggcaccacctgtttgatgcaaaaaggaacaatgtgacgatgcttctggaaattaactacagagagagaattctgaatgtttataacgaggttaaaaagcgtttggattatcaggtagctctgcaacatctccagcgtcgcaaggagcaggatcatatgatcaactgggtagaaaaaaatgtaatacagagtattaccccccaacagcaaaaggagagcattgccaaatgtatcacagacctgaaagttctatccaagactgcacaagcaagtgtttaatttctatcctgctgaagaattgtatctgcaggctccatctgtctgagaaactttctgtgtataaatgttaatatttctacactctaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaa
Translation: MLSRAALTSASALRKTAPLSVGLLNQCRSFHKGQPAMAPVPPLPEKGGKVRFGLIPEEFFQFLYPKTGVTGPYMLGTGLLVYLLSKEIYVINHETFAAASIGIVIVYGIKKFGPSVAAFADKLNEEKVAKAQAVKDSALKNLERAIEEENKEQWRVEGRHHLFDAKRNNVTMLLEINYRERILNVYNEVKKRLDYQVALQHLQRRKEQDHMINWVEKNVIQSITPQQQKESIAKCITDLKVLSKTAQASV
Donor tissue: tadpole