ORFeome > MGC75768 – XORFeome 2.0

MGC75768 – XORFeome 2.0

General Information

Species: Xenopus tropicalis ribosomal protein SA, mRNA (cDNA clone MGC:75768 IMAGE:5381822), complete cds
Gene Symbol: MGC75768
Gene ID: 394665
ORF gb_acc: MG132930
ORF ID: 10297

ORF full-length analysis tests

Clone type: Full Length
XGC accession: BC061298

Library Location

Plate ID: GDExt11003
Well Location: B06

EST Sequences

Clone: MGC:75768 IMAGE:5381822
Trimmed Sequence: ATGTCCGGAGGTCTTGATGTCCTGCAGATGAAGGAGGAAGATGTCCTCAAGTTCCTGGCAGCAGGGACCCACTTGGGGGGCACCAATCTTGACTTCCAGATGGAGCAGTATATCTATAAAAGGAAGAGTGATGGAATCTACATAATTAACCTGAAACGCACCTGGGAAAAGCTTTTGCTTGCAGCACGTGCCATTGTAGCTATTGAGAATCCTGCTGATGTGTGTGTCATTTCTTCAAGGAACACTGGCCAGCGTGCTGTACTGAAGTTTGCTTCTGCCAGTGGTGCTACGCCTATTGCTGGTCGCTTCACCCCTGGTACCTTCACCAACCAGATCCAGGCTGCTTTTCGGGAACCTCGGTTGCTAGTGGTGACAGATCCCCGGGCAGATCACCAACCCCTTACTGAGGCTTCATATGTCAACATTCCCACCATTGCCTTGTGTAATACAGATTCACCACTGCGCTATGTGGATATTGCTATCCCATGTAATAACAAGGGTGCTCATTCTGTTGGTCTTATGTGGTGGATGTTGGCTCGTGAGGTTCTGCGCATGAGAGGCACAATCTCTCGTGAGCACCCCTGGGAGGTCATGCCCGATCTGTACTTCTACCGTGATCCAGAAGAAATTGAGAAGGAGGAACAGGCAGCTGCAGAGAAGGCTACCACCAAAGAAGAATACCAAGGAGAATGGACTGCACCTGTGGCAGAGTTCCCTCAGGCTGAGGTTGCTGACTGGTCTGAAGGTGTACAGGTCCCATCTGTTCCCATCCAGCAGTTTCCAGCTGAACGTCCAGAAATTCCAGCAGCAAAACCTGCAGCTGAAGACTGGAGTTCACAGCCAGCTAGTACTGATGACTGGTCTGCTGCCCCTACTGCTCAAGCATCAGAATGGACTGGAACCACTACTGAGTGGTCTTAA
Full Trace Sequence: ctccacacggctttgtctcccgttccccatcgtagctttaaaggggtaactcacaatgtccggaggtcttgatgtcctgcagatgaaggaggaagatgtcctcaagttcctggcagcagggacccacttggggggcaccaatcttgacttccagatggagcagtatatctataaaaggaagagtgatggaatctacataattaacctgaaacgcacctgggaaaagcttttgcttgcagcacgtgccattgtagctattgagaatcctgctgatgtgtgtgtcatttcttcaaggaacactggccagcgtgctgtactgaagtttgcttctgccagtggtgctacgcctattgctggtcgcttcacccctggtaccttcaccaaccagatccaggctgcttttcgggaacctcggttgctagtggtgacagatccccgggcagatcaccaaccccttactgaggcttcatatgtcaacattcccaccattgccttgtgtaatacagattcaccactgcgctatgtggatattgctatcccatgtaataacaagggtgctcattctgttggtcttatgtggtggatgttggctcgtgaggttctgcgcatgagaggcacaatctctcgtgagcacccctgggaggtcatgcccgatctgtacttctaccgtgatccagaagaaattgagaaggaggaacaggcagctgcagagaaggctaccaccaaagaagaataccaaggagaatggactgcacctgtggcagagttccctcaggctgaggttgctgactggtctgaaggtgtacaggtcccatctgttcccatccagcagtttccagctgaacgtccagaaattccagcagcaaaacctgcagctgaagactggagttcacagccagctagtactgatgactggtctgctgcccctactgctcaagcatcagaatggactggaaccactactgagtggtcttaagaacacaaatgtcccaagtgtgtaaggtcatgaaaagacggtgaaataaaatttcattttcacttttaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaa
Translation: MSGGLDVLQMKEEDVLKFLAAGTHLGGTNLDFQMEQYIYKRKSDGIYIINLKRTWEKLLLAARAIVAIENPADVCVISSRNTGQRAVLKFASASGATPIAGRFTPGTFTNQIQAAFREPRLLVVTDPRADHQPLTEASYVNIPTIALCNTDSPLRYVDIAIPCNNKGAHSVGLMWWMLAREVLRMRGTISREHPWEVMPDLYFYRDPEEIEKEEQAAAEKATTKEEYQGEWTAPVAEFPQAEVADWSEGVQVPSVPIQQFPAERPEIPAAKPAAEDWSSQPASTDDWSAAPTAQASEWTGTTTEWS
Donor tissue: tadpole