ORFeome > MGC75880 – XORFeome 2.0

MGC75880 – XORFeome 2.0

General Information

Species: Xenopus tropicalis lecithin retinol acyltransferase, mRNA (cDNA clone MGC:75880 IMAGE:5383085), complete cds
Gene Symbol: MGC75880
Gene ID: 394746
ORF gb_acc: MG133039
ORF ID: 10435

ORF full-length analysis tests

Clone type: Putative Full Length
XGC accession: BC061345

Library Location

Plate ID: GDExt11004
Well Location: E10

EST Sequences

Clone: MGC:75880 IMAGE:5383085
Trimmed Sequence: ATGAAATCACTATTAGTGGGAATGATTGTTTTTATTTTTGAAAAAATCTTTATTTTGGCCAACTTGAAAGTGTTTAGTGTATCGTCAAAAAAAAGCAGATGCAGGCAGCCTTGCAATGTTCCTTTTATCAAGAGAGGTGACTTGCTGGAAGTTCCTAGAACACTGTTTGTTCATTTTGGAATCTATTTAGGGAATAACAAAGTGGCCCATTTGATGCCGGATATTCTTCCAGCTCTGTCAGATGATACATGTTTAATAAGGAGAGTAGTGACGAACAAAAGGCTTATAATGGGCGTTTTGGCCAAGATAGCCAGCATAAGAGTGGACTCTGTGCAGGATTTTGCCTATGGTGGAAATATCTTAGTAAACCACATGGACAAAAGCTTCAAGACAAAACCTCTCACTAATGAAGAAGTGGCTCGGAGAGCAGAGAAACTGGTTGGATCTACACCTTACAGCCTTCTGTGGAACAACTGTGAGCACTTTGTCACTTACTGCAGATATGGCATGCCTGTCAGCTTTCAGACTGAGAAGTTCTGTGAGACAGTAAAGAAGATAATTCGAGATCGGAGAAGCATTTTACTTTCTGCTGCTATTGGCATGGCATCATTCCTATGTATGGGCTTTGGACTGTACACCATCCTTCCCAGTTTTTTCATTACCTTTACATTGTGGATGGCAAGCTAA
Full Trace Sequence: gcacaatgaaatcactattagtgggaatgattgtttttatttttgaaaaaatctttattttggccaacttgaaagtgtttagtgtatcgtcaaaaaaaagcagatgcaggcagccttgcaatgttccttttatcaagagaggtgacttgctggaagttcctagaacactgtttgttcattttggaatctatttagggaataacaaagtggcccatttgatgccggatattcttccagctctgtcagatgatacatgtttaataaggagagtagtgacgaacaaaaggcttataatgggcgttttggccaagatagccagcataagagtggactctgtgcaggattttgcctatggtggaaatatcttagtaaaccacatggacaaaagcttcaagacaaaacctctcactaatgaagaagtggctcggagagcagagaaactggttggatctacaccttacagccttctgtggaacaactgtgagcactttgtcacttactgcagatatggcatgcctgtcagctttcagactgagaagttctgtgagacagtaaagaagataattcgagatcggagaagcattttactttctgctgctattggcatggcatcattcctatgtatgggctttggactgtacaccatccttcccagttttttcattacctttacattgtggatggcaagctaaccatactggactacaacaagccagcaatgtacatgatttagaaagcatatcatgggctgcctgaatattattgactgaaggtcccattggcactgcatgatcttgtcccatcccaagcatcataatcaatgtgtggaagaaaaaggaacggtgtacaacatagttcagtcattcagtacctgtactataattaatgtttacatttgctaaatattattactgtttaagctgtttattttcttctatgttattacaagtgaatagtctcagtacaatgggagttgtggctatacaactattaacatgtacacataagatcatctttataaagctgtgtaaaagtattataatatcattaccaatgacattatcacaccatgattctccatgtaaaagcatacatataagtgtaaaatatttcacacagctttattagtatggcccaaagtcttttgtgagcaacatatagaacagcagaaccagagaacctggaaaagaagtagctaaataaatcatgggctacaaaacaaaatcccctaagctgttacagagcaagctgtgagtgaaagctttaggcagtactgaatgatacctcatgaacagagtgaatccattggcagcctgtttctttgaaatgaattgcatttggatgtatgtatatctttatttatagtgcagcactgtatatatttacagtagagttatagttcaaacagggcacaaacactacaataaacaaatataagtacaattggtacagtcaagtgtcacatgttaagagacacaagagaaaggcggtcgctgccctggtggtttgtagcactttaaagaaaatattgtttttaagatatgatatttacattatggtattattattgcagggacaaccttcagtgcagtagatacatacatataccaatcatggatgagaatatgagcacagactggatataaggcaaatgctaaaagagtattgtcctcaattttaaaaatgcatttattaaagcttttcctgttaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaa
Translation: MKSLLVGMIVFIFEKIFILANLKVFSVSSKKSRCRQPCNVPFIKRGDLLEVPRTLFVHFGIYLGNNKVAHLMPDILPALSDDTCLIRRVVTNKRLIMGVLAKIASIRVDSVQDFAYGGNILVNHMDKSFKTKPLTNEEVARRAEKLVGSTPYSLLWNNCEHFVTYCRYGMPVSFQTEKFCETVKKIIRDRRSILLSAAIGMASFLCMGFGLYTILPSFFITFTLWMAS
Donor tissue: neurula