ORFeome > MGC75933 – XORFeome 2.0

MGC75933 – XORFeome 2.0

General Information

Species: Xenopus tropicalis hypothetical protein MGC75933, mRNA (cDNA clone MGC:75933 IMAGE:5383824), complete cds
Gene Symbol: MGC75933
Gene ID: 394638
ORF gb_acc: MG132979
ORF ID: 10358

ORF full-length analysis tests

Clone type: Putative Full Length
XGC accession: BC061372

Library Location

Plate ID: GDExt11004
Well Location: G05

EST Sequences

Clone: MGC:75933 IMAGE:5383824
Trimmed Sequence: ATGTCGGCGCCGGCGGCCAAAGTCAGTAAAAAGGAGGTGAACTCCAACCACGACGGAGCGGACGAGACCTCAGAAAAAGAGCAACAGGAAGCCATTGAGCATATTGACGAAGTACAAAATGAAATAGACAGACTGAACGAACAGGCAAGCGAAGAAATATTGAAAGTAGAACAGAGATACAACAAACTTCGTCAGCCATTTTTCCAGAAGAGGTCAGAGTTGATCGCCAAAATCCCTAACTTCTGGGTTACAACATTTGTCAATCACCCACAAGTATCAGCATTACTGGGTGAGGAAGATGAAGAAGCACTTCACTATCTGACTCGGGTGGAGGTTACAGAGTTTGAAGACATAAAATCGGGTTACAGAATAGATTTTTATTTTGATGAAAATCCCTACTTCGAAAACAAAGTTCTCTCTAAAGAATTCCACTTGAATGAAAGTGGAGACCCATCTTCAAAGTCAACTGAGATAAAATGGAAAGCAGGGAAGGATTTAACAAAGCGTTCCAGCCAGACACAGAACAAAGCTAGCAGGAAGAGGCAACATGAAGAGCCAGAAAGCTTTTTCACTTGGTTCACAGATCATTCTGACGCAGGGGCTGATGAACTTGGAGAGGTTATTAAGGATGACATCTGGCCAAACCCACTGCAGTACTACCTGGTCCCCGATATGGAAGATGAAGAAGCAGAGGGTGAGGAAGAGGATGATGATGACGAGGAAGAGGAGGGACTGGAAGATATCGATGAGGAGGGTGATGAAGATGAGGGTGAAGGAGAGGACGATGATGACGAAGATGAAGAGGGAGAAGAAGCGGAGGTATGA
Full Trace Sequence: gttggtgccgagcgcgtccccccgccccctccttcctttttctctctcacacacgcacgggagcgagatcttccctcacacacagcagcggccattgcgccttcttctactttcccctttctccctctcagctcggcacccggcaaacacacaccgaagcagcttcctctctctgtgtttccccctccccttccagccaggcctgagcctgcactccctccccccccgccttgcgctctcaccgcttctcacacacacaacatgtcggcgccggcggccaaagtcagtaaaaaggaggtgaactccaaccacgacggagcggacgagacctcagaaaaagagcaacaggaagccattgagcatattgacgaagtacaaaatgaaatagacagactgaacgaacaggcaagcgaagaaatattgaaagtagaacagagatacaacaaacttcgtcagccatttttccagaagaggtcagagttgatcgccaaaatccctaacttctgggttacaacatttgtcaatcacccacaagtatcagcattactgggtgaggaagatgaagaagcacttcactatctgactcgggtggaggttacagagtttgaagacataaaatcgggttacagaatagatttttattttgatgaaaatccctacttcgaaaacaaagttctctctaaagaattccacttgaatgaaagtggagacccatcttcaaagtcaactgagataaaatggaaagcagggaaggatttaacaaagcgttccagccagacacagaacaaagctagcaggaagaggcaacatgaagagccagaaagctttttcacttggttcacagatcattctgacgcaggggctgatgaacttggagaggttattaaggatgacatctggccaaacccactgcagtactacctggtccccgatatggaagatgaagaagcagagggtgaggaagaggatgatgatgacgaggaagaggagggactggaagatatcgatgaggagggtgatgaagatgagggtgaaggagaggacgatgatgacgaagatgaagagggagaagaagcggaggtatgaagacgaaggtgaagatgattaagtgatctcattgtttggattccacccttttcctttttttttatccagcccctgggagcaagatgctgtcgtatatataatttcagttttttttttctttttatttcgtgtgctcagtcgccttgttctcttggtccttttcccctctccataccatggttcatgaatccctttttttttttttttcctcccctcccccttggggaggggtaagaactgagtaaaacgcagtggaaatctctaaccattttattttcccccccaagtccatacttctcgtctccaacaataaactttaaactttgtaaaaaaaaaaaaaaaaaaaaaa
Translation: MSAPAAKVSKKEVNSNHDGADETSEKEQQEAIEHIDEVQNEIDRLNEQASEEILKVEQRYNKLRQPFFQKRSELIAKIPNFWVTTFVNHPQVSALLGEEDEEALHYLTRVEVTEFEDIKSGYRIDFYFDENPYFENKVLSKEFHLNESGDPSSKSTEIKWKAGKDLTKRSSQTQNKASRKRQHEEPESFFTWFTDHSDAGADELGEVIKDDIWPNPLQYYLVPDMEDEEAEGEEEDDDDEEEEGLEDIDEEGDEDEGEGEDDDDEDEEGEEAEV
Donor tissue: neurula