ORFeome > MGC75947 – XORFeome 2.0

MGC75947 – XORFeome 2.0

General Information

Species: Xenopus tropicalis Microtubule-associated protein RP/EB family member 1, mRNA (cDNA clone MGC:75947 IMAGE:5383971), complete cds
Gene Symbol: MGC75947
Gene ID: 394720
ORF gb_acc: MG133499
ORF ID: 11023

ORF full-length analysis tests

Clone type: Putative Full Length
XGC accession: BC061382

Library Location

Plate ID: GDExt11009
Well Location: F11

EST Sequences

Clone: MGC:75947 IMAGE:5383971
Trimmed Sequence: ATGGCTGTTAATGTCTATTCAACATCTGTGACTAGTGACAACCTGAGCCGCCATGATATGCTGGCATGGATCAACGAGTCCTTACAGCTGAACCTAACTAAAATCGAACAGTTGTGTTCAGGCAGTGTATATTGCCAGTTCATGGACATGCTTTTCCCTGGATCAGTCGTGCTGAAAAAAGTAAAATTTCAAGCAAAACTGGAACATGAATACATTCAAAACTTCAAGGTCCTGCAAGCGGGCTTCAAAAAAATGGGTGTGGATAAGATAATTCCTGTGGACAAACTGGTAAAAGGAAAGTTCCAGGACAATTTTGAATTTGTGCAGTGGTTCAAAAAATTTTTCGATGCAAATTATGATGGGAAAGACTACGACCCTGTTGCAGCTCGTCAGGGACAGGAGTCGGCCCCAGTTCCAGTACTGGCTGCTCCAGTCCTGAACAAGCCTAAGAAACCTTTAGGCTCTGGAAACACAGCTCCCCAAAGGACAGTGCCTGTTCAGAGGACTGCAGTAAGTAACAAGCCGCCGGCCCAAGGCATCAGCAAGAAGCCAGCGACTGTAGGGAATGGAGACGATGAGTCTGCAGAGCTCATTCAGCAGATAAATGTACTGAAAATTACCGTTGAGGATCTAGAAAAGGAAAGAGACTTTTACTTTGGCAAATTGAGAAATATTGAGCTAATTTGTCAGGAGAATGAAGGTGAAAGTGACCCTGTTTTACAGAGGATTATAGAGATTCTATACGCCACAGACGAGGGCTTTGTCATACCTGATGAAGGAGCGCCCCCTGAAGACCAAGAAGAATATTAA
Full Trace Sequence: gcctgagagaaaatggctgttaatgtctattcaacatctgtgactagtgacaacctgagccgccatgatatgctggcatggatcaacgagtccttacagctgaacctaactaaaatcgaacagttgtgttcaggcagtgtatattgccagttcatggacatgcttttccctggatcagtcgtgctgaaaaaagtaaaatttcaagcaaaactggaacatgaatacattcaaaacttcaaggtcctgcaagcgggcttcaaaaaaatgggtgtggataagataattcctgtggacaaactggtaaaaggaaagttccaggacaattttgaatttgtgcagtggttcaaaaaatttttcgatgcaaattatgatgggaaagactacgaccctgttgcagctcgtcagggacaggagtcggccccagttccagtactggctgctccagtcctgaacaagcctaagaaacctttaggctctggaaacacagctccccaaaggacagtgcctgttcagaggactgcagtaagtaacaagccgccggcccaaggcatcagcaagaagccagcgactgtagggaatggagacgatgagtctgcagagctcattcagcagataaatgtactgaaaattaccgttgaggatctagaaaaggaaagagacttttactttggcaaattgagaaatattgagctaatttgtcaggagaatgaaggtgaaagtgaccctgttttacagaggattatagagattctatacgccacagacgagggctttgtcatacctgatgaaggagcgccccctgaagaccaagaagaatattaaccatacatacacctgcatcgcagtcgtttattgcccaaatcatgtgcttaacgttaaatacccccttttattctcagagggctgtttctctgcacggagggggcagcacctttccttttgaaagtgcactttgccaaagtttcactcattttacagtgcttagggattggacatactatggttttgtggcaggaaagtgtgtgtaatgggctgaggaaggttcagttactggtcagactgttatagtggtgttgtacagtatatataccaatgccttaaggggtttctaaatgcttttctaagtcatacagtaaatgtgtatgtgggcagctccttgcagtgtctagtgcttgtgagtagggacgtgccgaggtgctgctccttgcagtgtatagtgcttgtgaggagggacttgcccaaggggctactccttgcagtgtatagtgcttttgagtaggaacgtgccagaggggctgctccttgcagtgtatagtgcttgtgagtagggacgaacccgaggggctgctccttgcagtgtgtagtgcttgtgagtagggacgtgcccgaggggctgctccttgtgccgaatcctgctgctcttcttctgctctgtctgcacatggaattgagattgtgcccccccccggcagcctgggggttaacatgtacctgtactaaaatgagatgaaatttaccgagtggcaaacctctgagttatcagcatttcccttttcacatgaatttgtgtccgacaccctcttcctttgttttaatattgtgagaccttgtatttatgttcctgttgcgcctccttcttcttctgtacctgctgtgcccccctgtgccccatttctccaggcttcacctctggagcaggaaccctgctgtttttacaataaattgggatttggtgatgccataacaagtgggaattgctttattacacatttacttttgcccgtgattgagtagccggccacttgcagtgctttctagtcctctcctgcccttttacacttactctcttctccttctctttttatttggtttcacttagagtttttctactttaaatcatttctaaataaaacttctgcatttcaagagtttaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaa
Translation: MAVNVYSTSVTSDNLSRHDMLAWINESLQLNLTKIEQLCSGSVYCQFMDMLFPGSVVLKKVKFQAKLEHEYIQNFKVLQAGFKKMGVDKIIPVDKLVKGKFQDNFEFVQWFKKFFDANYDGKDYDPVAARQGQESAPVPVLAAPVLNKPKKPLGSGNTAPQRTVPVQRTAVSNKPPAQGISKKPATVGNGDDESAELIQQINVLKITVEDLEKERDFYFGKLRNIELICQENEGESDPVLQRIIEILYATDEGFVIPDEGAPPEDQEEY
Donor tissue: neurula