ORFeome > MGC76017 – XORFeome 2.0

MGC76017 – XORFeome 2.0

General Information

Species: Xenopus tropicalis hypothetical protein MGC76017, mRNA (cDNA clone MGC:76017 IMAGE:5384687), complete cds
Gene Symbol: MGC76017
Gene ID: 394564
ORF gb_acc: MG133482
ORF ID: 11005

ORF full-length analysis tests

Clone type: Putative Full Length
XGC accession: BC061419

Library Location

Plate ID: GDExt11009
Well Location: B06

EST Sequences

Clone: MGC:76017 IMAGE:5384687
Trimmed Sequence: ATGGTGTCAGTAATAAACACCGTGGACACTTCCCATGAGGATATGATTCATGATGCCCAGATGGATTATTATGGCACTCGTCTTGCTACTTGTTCCTCTGATCGATCTGTGAAGATCTTTGATGTGAAGAATGGAGGGCAGATCCTGATAGCTGACCTGCGCGGGCACGAGGGTCCGGTTTGGCAGGTTGCGTGGGCCCACCCTATGTATGGAAACATCCTGGCCTCCTGCTCCTATGACCGAAAAGTAATCATTTGGAAAGAAGAAAATGGGACCTGGGAGAAGACGTATGAATACACAGGGCATGACTCCTCCGTAAATTCTGTTTGCTGGGCTCCCCATGACTTGGGGCTCGTGCTGGCATGTGGCAGTTCGGATGGAGCGATCTCCATTCTCACCTATACTGGAGATGGGCCCTGGGAAGTGAAGAAGATCAGCAATGCACACACAATTGGGTGTAACGCAGTGAGCTGGGCTCCTTCTGTTGTCCCTGGAAGCCTTGTCGATCAGCCATCAAGTCAGAAGCCCAATTACATTAAGAGATTTGTGTCTGGTGGATGTGATAACTTAGTGAAAATCTGGAGGGAGGAAGATGGCCAGTGGAAAGAGGATCAGAAGCTGGAAGCTCACAGTGATTGGGTGCGGGATGTGGCCTGGGCTCCCTCCATTGGTTTGCCCACTAGCACCATTGCTAGTTGCTCTCAGGACGGGCGGGTATATATCTGGACAAGTGATGATGCTGCCACCAACTGTTGGAACCCAAAACTTCTGCACAAGTTTAATGATGTCGTTTGGCACGTGAGCTGGTCCATCACAGCTAATATCCTGGCTGTGTCTGGGGGAGATAACAAGGTGACTTTATGGAAGGAGTCTGTGGATGGACAGTGGGCCTGTATCAGTGATGTAAACAAGGGGCAAGGAGCCGTCTCCACCGTGACAGATGGACAGTTGAATGAGCAGTGA
Full Trace Sequence: cggacacggaagtacggacacggaagtacggctgggtactgcagcgcactacacccggaagtgattattgttgcagccggagcaaacgaagcgctgtacacccggaagttctgctgagcaagatcctgcgaggagctgccgggagctgccacgtctgagaataggggagagttattttgtagctaaggaacctcagtcggtctaggaaaatggtgtcagtaataaacaccgtggacacttcccatgaggatatgattcatgatgcccagatggattattatggcactcgtcttgctacttgttcctctgatcgatctgtgaagatctttgatgtgaagaatggagggcagatcctgatagctgacctgcgcgggcacgagggtccggtttggcaggttgcgtgggcccaccctatgtatggaaacatcctggcctcctgctcctatgaccgaaaagtaatcatttggaaagaagaaaatgggacctgggagaagacgtatgaatacacagggcatgactcctccgtaaattctgtttgctgggctccccatgacttggggctcgtgctggcatgtggcagttcggatggagcgatctccattctcacctatactggagatgggccctgggaagtgaagaagatcagcaatgcacacacaattgggtgtaacgcagtgagctgggctccttctgttgtccctggaagccttgtcgatcagccatcaagtcagaagcccaattacattaagagatttgtgtctggtggatgtgataacttagtgaaaatctggagggaggaagatggccagtggaaagaggatcagaagctggaagctcacagtgattgggtgcgggatgtggcctgggctccctccattggtttgcccactagcaccattgctagttgctctcaggacgggcgggtatatatctggacaagtgatgatgctgccaccaactgttggaacccaaaacttctgcacaagtttaatgatgtcgtttggcacgtgagctggtccatcacagctaatatcctggctgtgtctgggggagataacaaggtgactttatggaaggagtctgtggatggacagtgggcctgtatcagtgatgtaaacaaggggcaaggagccgtctccaccgtgacagatggacagttgaatgagcagtgaccatccagagatgtcataaaagtgtgtccattttagttttgcccaacaccagtccttcaagctactttggcatccaaggggttaattctacctggacaatttgcacatgatttttaacccctcatgtgcacagaggactgtacttaatggcagcatagggaactaattgtcattcgtattctctttgggattttctggtctcagcaacataaattatctgcaaagtgtttccttcctttttcacagaaagaagaacaattggagtcaaaaccaatttcagtgattataagctgcttcccccaatatcagttcttgtgttcagggcagaccctttagccgcacaggtaggaccatccccttatgcacctgtgctcctttgattgaagggggggggtcttctctttatctgccctgctaggcaagtatagggagctactgtatcagatgctcagagagagcacttcattccagtgactcccctcccacttgccttaaagtttccccttcactaaaaatgtaggtttgttttttccaaaaaaatgttgttctcaagctggaataaaggtttatctacataataatttcacagattaaaagatatggtttttaaaaaaaaaaaaaaaaaaaaaaaaaaa
Translation: MVSVINTVDTSHEDMIHDAQMDYYGTRLATCSSDRSVKIFDVKNGGQILIADLRGHEGPVWQVAWAHPMYGNILASCSYDRKVIIWKEENGTWEKTYEYTGHDSSVNSVCWAPHDLGLVLACGSSDGAISILTYTGDGPWEVKKISNAHTIGCNAVSWAPSVVPGSLVDQPSSQKPNYIKRFVSGGCDNLVKIWREEDGQWKEDQKLEAHSDWVRDVAWAPSIGLPTSTIASCSQDGRVYIWTSDDAATNCWNPKLLHKFNDVVWHVSWSITANILAVSGGDNKVTLWKESVDGQWACISDVNKGQGAVSTVTDGQLNEQ
Donor tissue: neurula