ORFeome > MGC76046 – XORFeome 2.0

MGC76046 – XORFeome 2.0

General Information

Species: Xenopus tropicalis hypothetical protein MGC76046, mRNA (cDNA clone MGC:76046 IMAGE:5385056), complete cds
Gene Symbol: MGC76046
Gene ID: 394614
ORF gb_acc: MG133505
ORF ID: 11029

ORF full-length analysis tests

Clone type: Putative Full Length
XGC accession: BC061435

Library Location

Plate ID: GDExt11010
Well Location: F04

EST Sequences

Clone: MGC:76046 IMAGE:5385056
Trimmed Sequence: ATGGGGAATGTATTTGCCAATCTCTTCAAAGGCCTTTTTGGCAAGAAGGAGATGCGTATTCTCATGGTGGGTTTGGATGCCGCTGGAAAGACCACCATTTTGTACAAACTGAAACTGGGAGAAATAGTAACAACTATTCCAACAATAGGCTTTAATGTTGAAACAGTAGAATACAAGAACATCAGTTTCACAGTGTGGGACGTGGGTGGTCAGGATAAGATTCGACCTCTGTGGCGTCACTACTTCCAAAACACACAAGGTTTAATCTTTGTGGTGGACAGTAACGACCGTGAGCGAGTAAATGAAGCCAGGGAAGAGCTTATGAGAATGTTAGCAGAAGATGAACTCCGTGATGCAGTCTTACTAGTATTTGCTAACAAACAGGACTTGCCTAATGCCATGAATGCAGCAGAAATCACAGACAAGTTAGGCCTGCATTCCCTTCGCCATAGGAACTGGTACATCCAGGCTACATGCGCCACTAGCGGAGATGGGCTTTATGAAGGACTGGACTGGTTGTCCAATCAGCTCCGAAACCATAAATGA
Full Trace Sequence: cagaaccgcaggaagggcggcagagagcggggttgggaggcctgtaagcggataccgagcggcactgtgagcagctgtgacaggttttatcatccagtcttaataacctcatatttccaatatggggaatgtatttgccaatctcttcaaaggcctttttggcaagaaggagatgcgtattctcatggtgggtttggatgccgctggaaagaccaccattttgtacaaactgaaactgggagaaatagtaacaactattccaacaataggctttaatgttgaaacagtagaatacaagaacatcagtttcacagtgtgggacgtgggtggtcaggataagattcgacctctgtggcgtcactacttccaaaacacacaaggtttaatctttgtggtggacagtaacgaccgtgagcgagtaaatgaagccagggaagagcttatgagaatgttagcagaagatgaactccgtgatgcagtcttactagtatttgctaacaaacaggacttgcctaatgccatgaatgcagcagaaatcacagacaagttaggcctgcattcccttcgccataggaactggtacatccaggctacatgcgccactagcggagatgggctttatgaaggactggactggttgtccaatcagctccgaaaccataaatgaaacctgcatccttattgttttgtttttttttcctgttcatgccttcctcattcctcctcccccccctatgcttctctctgatgtggcagtctgtgctactttgcggtatcgagtgccggaatcagtccattttctcctcccccccgcagtacgtattgcaccgcgctgtaaatgtggcacgagaaaagcctgcaaacagttaggtgtcttatttaatgtaaatagtttgtttccaatgaggcagtttctggtactcctatgcaatactaccctaaatttttttaaaacttctcaaaaaaaaatcaccacttcgtactggaaaaggggcaaaagcagaaaaataaaaaataatcgcaagtctcacgtgctttttccaaggctattgtaccccactgcaggaatcgagtacactgctcgtttttaaaataacatatttttttcccaatcggtcacgcgcttgagaatgtctcgttatcgccctagcagccaaacacagtggcggcggattggccctttaccgggtggggcagagcagtctcctgtatcccagccggcgctaaaggcgttggttttgccgcgttcccgtcgatattaagcagggcttgaaacctacgtaacctctggtgctagagggcttgttgtaatgttacatgacaggagttcaactcagtgattctctctctttctttctttgcatggttacagtgcagctccatggaattgctatgtcactggatctgcctgcattttatagcttttgtgcttatgattgtgctcaagtgaagactaagactatttattatgtgaccgaagccaagccgagagtgtaaataaagtgggcatttttcattgttggccatcacactggaacaaaagcaacactttttttttttttcttctttttcatcttagcatgggggtgggggcatgtactttccaggctgtgcttctgcattgcgatttcttgctacctacgctggccgttccttcttgaatgggtttccatatgtcatgtcacgtaaaaaccaccccccttttttggggccaactatgaggaatcgtcatgcctcatccaaatgcattttgttgcttaatcttctcattcattagtctatgtaggaaaccgccttcgacagatagcgaccagccaatctgcatcggaggttattaaattgctttgcagcttttctatgagggtttttgtactcgttgcagtctttgcagagagcacacagaacaccagtcctgcttggccattaggtagacagcactgcatctcatggggaacacatctagcactcttctatgtatggcaagtagaaatctatgtttagtcattccgctctagaacaatttttgggccttttttccgttttcatcttgcccagttcttggagtacatacgaaatcattccccactgcaaggatctaatcacgaaaaacatttttttttttaatattttttgttttctcgtacttctaaacgacactgaaaaagctggacttagtggagcgtgaagacctgtcagagctggtttatttagtgatgtggaatctattgctttcagtaaacaaattgtaatcaaatgttttgtattcttgttttcatttggacaaacaagcactgtaattaaagctattagaataaagttccatctatttcaaaaaaaaaaaaaaaaaaaaaaaaaataaaaaaaaaaaaaaaaaaaaaa
Translation: MGNVFANLFKGLFGKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRERVNEAREELMRMLAEDELRDAVLLVFANKQDLPNAMNAAEITDKLGLHSLRHRNWYIQATCATSGDGLYEGLDWLSNQLRNHK
Donor tissue: gastrula