ORFeome > MGC76064 – XORFeome 2.0

MGC76064 – XORFeome 2.0

General Information

Species: Xenopus tropicalis hypothetical protein MGC76064, mRNA (cDNA clone MGC:76064 IMAGE:5307564), complete cds
Gene Symbol: MGC76064
Gene ID: 394518
ORF gb_acc: MG132736
ORF ID: 10036

ORF full-length analysis tests

Clone type: Full Length
XGC accession: BC061607

Library Location

Plate ID: GDExt11001
Well Location: C04

EST Sequences

Clone: MGC:76064 IMAGE:5307564
Trimmed Sequence: ATGGCTGTCAGATCTCACTACCAGGGGTATGGACTGGAAGACGTGGTGTGGGAACAGTATACTGTCACATTGCAAAAGGACACCAGAAAAGGATTTGGCATTGCTGTTTCTGGAGGAAGAGACAATCCACACTTCCAGAATGGCGACAACTCCATTGTGATCTCAGATGTACTTATAGGGGGGCCTGCAGAGGGTCGGCTTCTAGAGAATGACAGGGTTATAATGGTTAATGGGACCCTTCTTGAGAATGTGCCACATTCTTTTGCCGTTCAGCAGCTGAGAAAATGTGGGAAAACAGCAGTTCTGGTGGTGAAAAGACCACGGAAGATACAGCTGGGTCCTCCAAGCAAATCAGAGCCTGCCCTAGATGTAATGGATGACTATCCTGAATATGAGAGCAGAACCGCCTATAGTGCATATAGCGACAGGAGTGGATATGGGGGCTCCCGCAGCCGTGATACAAGCCCAGACAGAAGCTTAAGAAGGGAGCAAGATAGAGGTCATTATTATGAACGAGAACAGGGCGGTTATGGCAGCCGTGCCCGAAGCGTTGACCAAGATCTTAATATGGAATATGGACAGAGGCGGGACCATAGTCGTGGTAGGAGCATTGACCGGGATTTGGATGAGGATCGTGGGTACAGGAGAGACCATAGTCGTGGTAGAAGCATAGACAGAGACCTGGATGATGACCGTGGCTACAGAAGAGATCGCAGTCGTGGTAGAAGCTTAGATCGTGAGCTAGATGACCAGCGTGATTACAGAAGAGACAACAGCCGTGGTCGCACCTTAGATAGAGATGTGATGTATGACAGAGGTGGAGATTACAGTCCAGAAAGAGATACGGGGAGAAAAACCTATGAAAAGGAAATTCAGAAAAGTCGTAGCCGAGATAGACTACAGTCTCGTAGCCCATCGCCTCAAAATAAAGGTTCAGACAAAACCAAAAGTGTTCTTCTGACAAAGAACAAGTCAAATGAAGAATATGGCCTTCGCCTTGGCAGCCAGATTTACATCAAGGGGTTGACAGGGACTGGTTTGGCAGGAAAAGATGGGAATTTACATGAAGGAGATATCATACTCAAGATTAACGGTACTCTGACTGAGAACATGTCTTTACTGGATGCCCAGGCTTTAATAGAGAAATCGCGAGGAAAGCTTCAGCTTGTGGTTCTTAGAGACAAAAAGCAGACACTGATCAATCTGCCTTATGTGGAAGACAGTGATTCAGAAATGGAAGAGGATTATTCACACAAGAGGAGGAATCCAAGGTCTAAGGAGCCATAA
Full Trace Sequence: gaggaactggaattctttctcccccacctttacttacttccaaaatggctgtcagatctcactaccaggggtatggactggaagacgtggtgtgggaacagtatactgtcacattgcaaaaggacaccagaaaaggatttggcattgctgtttctggaggaagagacaatccacacttccagaatggcgacaactccattgtgatctcagatgtacttataggggggcctgcagagggtcggcttctagagaatgacagggttataatggttaatgggacccttcttgagaatgtgccacattcttttgccgttcagcagctgagaaaatgtgggaaaacagcagttctggtggtgaaaagaccacggaagatacagctgggtcctccaagcaaatcagagcctgccctagatgtaatggatgactatcctgaatatgagagcagaaccgcctatagtgcatatagcgacaggagtggatatgggggctcccgcagccgtgatacaagcccagacagaagcttaagaagggagcaagatagaggtcattattatgaacgagaacagggcggttatggcagccgtgcccgaagcgttgaccaagatcttaatatggaatatggacagaggcgggaccatagtcgtggtaggagcattgaccgggatttggatgaggatcgtgggtacaggagagaccatagtcgtggtagaagcatagacagagacctggatgatgaccgtggctacagaagagatcgcagtcgtggtagaagcttagatcgtgagctagatgaccagcgtgattacagaagagacaacagccgtggtcgcaccttagatagagatgtgatgtatgacagaggtggagattacagtccagaaagagatacggggagaaaaacctatgaaaaggaaattcagaaaagtcgtagccgagatagactacagtctcgtagcccatcgcctcaaaataaaggttcagacaaaaccaaaagtgttcttctgacaaagaacaagtcaaatgaagaatatggccttcgccttggcagccagatttacatcaaggggttgacagggactggtttggcaggaaaagatgggaatttacatgaaggagatatcatactcaagattaacggtactctgactgagaacatgtctttactggatgcccaggctttaatagagaaatcgcgaggaaagcttcagcttgtggttcttagagacaaaaagcagacactgatcaatctgccttatgtggaagacagtgattcagaaatggaagaggattattcacacaagaggaggaatccaaggtctaaggagccataaatcaggaaccgactcatgacgtggggttttaaaaggccaaaagaacatttttttctaccctttttcctaaatattttgagaattatttgtatttcatattccattaaacattgattaaccataaaaaaaaaaaaaaaaaaaaaaaaaa
Translation: MAVRSHYQGYGLEDVVWEQYTVTLQKDTRKGFGIAVSGGRDNPHFQNGDNSIVISDVLIGGPAEGRLLENDRVIMVNGTLLENVPHSFAVQQLRKCGKTAVLVVKRPRKIQLGPPSKSEPALDVMDDYPEYESRTAYSAYSDRSGYGGSRSRDTSPDRSLRREQDRGHYYEREQGGYGSRARSVDQDLNMEYGQRRDHSRGRSIDRDLDEDRGYRRDHSRGRSIDRDLDDDRGYRRDRSRGRSLDRELDDQRDYRRDNSRGRTLDRDVMYDRGGDYSPERDTGRKTYEKEIQKSRSRDRLQSRSPSPQNKGSDKTKSVLLTKNKSNEEYGLRLGSQIYIKGLTGTGLAGKDGNLHEGDIILKINGTLTENMSLLDAQALIEKSRGKLQLVVLRDKKQTLINLPYVEDSDSEMEEDYSHKRRNPRSKEP
Donor tissue: gastrula