ORFeome > MGC76077 – XORFeome 2.0

MGC76077 – XORFeome 2.0

General Information

Species: Xenopus tropicalis hypothetical protein MGC76077, mRNA (cDNA clone MGC:76077 IMAGE:5307749), complete cds
Gene Symbol: MGC76077
Gene ID: 394969
ORF gb_acc: MG132735
ORF ID: 10035

ORF full-length analysis tests

Clone type: Full Length
XGC accession: BC064195

Library Location

Plate ID: GDExt11001
Well Location: D03

EST Sequences

Clone: MGC:76077 IMAGE:5307749
Trimmed Sequence: ATGCCGAAGGTAGTGTCACGGTCTGTAGTTTGCTCAGATACCCGGGACCGAGAGGAGTACGATGATGGGGAGAAGCCGCTACACGTGTATTACTGTCTCTGCGGGCAGATGGTGTTGGTGCTTGACTGCCAGCTGGAGAAACTTCCCATGAGGCCAAGGGATAAAGCAAGAGTCATAGATGCAGCGAAGCATGCTCATAAGTTCTGCAATACCGAGGAGGAGGAGCCTGTGTATCTGCGCAGGCCAGATGGCATTGAGCGACAATACAGGAAAAAGTGCAGCAAGTGTAGCCTTCTTCTCTTCTACCAACACAGCCAGAAGAATGTGGCAGCTACCTTTATAGTGAATGGGGCTCTGGTCAAGTTTGGACAGGGTTTTGGAAAAACGAATATCTATACTCAAAAACCGGACCCACCAAAGAAGGTAATGATGACCAAGCGTACAAAGGACATGGGCAAATTCAGTTCTGTCACTGTGTCGACAATTGATGAAGAAGAGGAGGAGATTGAAGCGAGAGAAGTTGCAGATTCCTATGCTCAGAATGCCAAAGTAATTGAAAAGCAGCTGGAAAGAAAGGGAATGAGCAAGAGGAGGCTACAGGAGTTGGCTGAGTTGGAAGCTAAGAAAGCCAAGATGAAAGGCACACTAATTGACAACCAGTTCAAATAG
Full Trace Sequence: caggaacataaggatgccgaaggtagtgtcacggtctgtagtttgctcagatacccgggaccgagaggagtacgatgatggggagaagccgctacacgtgtattactgtctctgcgggcagatggtgttggtgcttgactgccagctggagaaacttcccatgaggccaagggataaagcaagagtcatagatgcagcgaagcatgctcataagttctgcaataccgaggaggaggagcctgtgtatctgcgcaggccagatggcattgagcgacaatacaggaaaaagtgcagcaagtgtagccttcttctcttctaccaacacagccagaagaatgtggcagctacctttatagtgaatggggctctggtcaagtttggacagggttttggaaaaacgaatatctatactcaaaaaccggacccaccaaagaaggtaatgatgaccaagcgtacaaaggacatgggcaaattcagttctgtcactgtgtcgacaattgatgaagaagaggaggagattgaagcgagagaagttgcagattcctatgctcagaatgccaaagtaattgaaaagcagctggaaagaaagggaatgagcaagaggaggctacaggagttggctgagttggaagctaagaaagccaagatgaaaggcacactaattgacaaccagttcaaatagaagaggcaacggccagaagattggcggtgtgaaaggccatcttgcctgacacttcggattgttaagaagagctatgacgtttgaggccggacccctgccttttgatgcaactgcacttgtcctttatgaaacagaatgcagagatgaacaggggatttaccagcagggaaaagcctccattccagtacattagagaggatgtgttgtatgagcacagcttatataaaaaaaacactgtcttttagcttaacttgactgtactgcatggactgaggttcagtgcttactcccttgactattgatctgggaacctcttgctttgcttttgtaaatatttgaaatatcaaacaaatggaaaacagactggaaaactatatgaagtggtggacacattttagagaaatacatttagttttacaggatatgccttgtgtgctgatattggtgccactgaaaattactaccaacatcgattgtaacttacccttggtaacaccattgctttttttcccaatgttcagcttcactgaactgaataatcatcagcagtgaacaccgaggtttgatttattattctttgtaataaagccattgtattgtcatttattactatgggcatcctttacagcttacccctgtggataaacctatccccagggatatgtatatttactataatacaaaggtatcaatatccacttccattgactgttaatggtagtacatgggatctgttatccagaattcttgggacctggtgtttttttagataaggaatcttcctgtaatttgaatcacaatacctgctaaaatcatttaaacaagaaataaacccaattggattgtttgtctaccaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaa
Translation: MPKVVSRSVVCSDTRDREEYDDGEKPLHVYYCLCGQMVLVLDCQLEKLPMRPRDKARVIDAAKHAHKFCNTEEEEPVYLRRPDGIERQYRKKCSKCSLLLFYQHSQKNVAATFIVNGALVKFGQGFGKTNIYTQKPDPPKKVMMTKRTKDMGKFSSVTVSTIDEEEEEIEAREVADSYAQNAKVIEKQLERKGMSKRRLQELAELEAKKAKMKGTLIDNQFK
Donor tissue: gastrula