ORFeome > MGC76078 – XORFeome 2.0

MGC76078 – XORFeome 2.0

General Information

Species: Xenopus tropicalis N-acetyltransferase 5, mRNA (cDNA clone MGC:76078 IMAGE:5307766), complete cds
Gene Symbol: MGC76078
Gene ID: 394715
ORF gb_acc:
ORF ID: 10046

ORF full-length analysis tests

Clone type: Full Length
XGC accession: BC062502

Library Location

Plate ID: GDExt11001
Well Location: E02

EST Sequences

Clone: MGC:76078 IMAGE:5307766
Trimmed Sequence: ATGACATCGCTTAGACCGTTCACATGCGATGACTTGTTTCGATTTAACAACATCAACCTGGATCCATTAACTGAGACTTATGGCATTCCTTTTTACCTGCAGTATTTGGCACACTGGCCTGAATATTTTATTGTTGCAGAGGCACCAGGTGGAGAACTCATGGGTTACATAATGGGAAAAGCCGAGGGTTCAGTAGCACGAGAGGAATGGCATGGACACGTCACTGCACTGTCTGTCGCACCAGAATTCCGACGTCTCGGGTTAGCAGCTAAACTAATGGAGTTACTAGAAGAAATTTCTGAAAGAAAAGGAGGATTTTTTGTTGATCTGTTTGTGAGAGTCTCCAATCAAGTTGCAGTGAACATGTACAAGCAGCTGGGATACAGTGTGTACCGAACTGTCATAGAGTATTACTCAGCCAGCAATGGGGAACCGGATGAAGATGCATATGACATGAGGAAAGCTCTGTCGAGAGACACTGAGAAGAAATCTATTGTACCTTTACCGCATCCTGTGAGACCAGAAGACATTGAATAA
Full Trace Sequence: gtggttctttgggtgttctaaaacttcacgagaaaatgacatcgcttagaccgttcacatgcgatgacttgtttcgatttaacaacatcaacctggatccattaactgagacttatggcattcctttttacctgcagtatttggcacactggcctgaatattttattgttgcagaggcaccaggtggagaactcatgggttacataatgggaaaagccgagggttcagtagcacgagaggaatggcatggacacgtcactgcactgtctgtcgcaccagaattccgacgtctcgggttagcagctaaactaatggagttactagaagaaatttctgaaagaaaaggaggattttttgttgatctgtttgtgagagtctccaatcaagttgcagtgaacatgtacaagcagctgggatacagtgtgtaccgaactgtcatagagtattactcagccagcaatggggaaccggatgaagatgcatatgacatgaggaaagctctgtcgagagacactgagaagaaatctattgtacctttaccgcatcctgtgagaccagaagacattgaataaccttagctgtggttcttaggtagagtcataaaaagacaatttcatctacatattctataaagcagcaacaccagtctgaggcttgctaggccatatgcacagttcctagcggagaagttaagttcagtaaatggttagagacacataattacttttctgtttatttataaaacacacctatttaatctactgcctcttacactgtaaagtcggttcttattcaggaaagttatacctggccagttacttttccaagtcgtattgctggcagacacaaatataaatgtgaccagagctggcagtgcatgtcactgactgtaatccatatttttacagaccatttacagcttgctgctgagttgtgtcctaggactggagggccatgcattttataagcttcatcttttaaagtaatagcgacatgtatctaggattgtattctatgtagaattttcctgtatattcctttttatttcctgtctgaaattgccatttttacagccatttacagcctgtccctaacttttaggggcatttttattattgtgtgtaaggcaacatcacaagtcatgtagatttatgcccattagggtagtgttagtgtgacatttccatatggcttggagagtggcagcattctcattcaggttattgtaagcgcagtatacagaaaaatgtacataacattactttatttgctaaaatgcaatagtaagaatatcagagagcctttttatttggtgattatgaaatgtgtatgttcctgctgcactaagaacaattcatagatgtaattatgtacctttgcctaagaatccagtgtaaatgattcctgtgatgtgtaacttccatggatggctgcactgcattctctgtgatgtcctgcagttttcaggtgctaacaaggtaatgacgctgtaaatggctgatggggcaaatgtaggcagaataaaatgtgctgctgtttgagtttaaaaaataaacaaaaaaataaaaaaaaaaaaaaaaaaaa
Translation: MTSLRPFTCDDLFRFNNINLDPLTETYGIPFYLQYLAHWPEYFIVAEAPGGELMGYIMGKAEGSVAREEWHGHVTALSVAPEFRRLGLAAKLMELLEEISERKGGFFVDLFVRVSNQVAVNMYKQLGYSVYRTVIEYYSASNGEPDEDAYDMRKALSRDTEKKSIVPLPHPVRPEDIE
Donor tissue: gastrula