ORFeome > MGC76136 – XORFeome 2.0

MGC76136 – XORFeome 2.0

General Information

Species: Xenopus tropicalis hypothetical protein MGC76136, mRNA (cDNA clone MGC:76136 IMAGE:5309397), complete cds
Gene Symbol: MGC76136
Gene ID: 394694
ORF gb_acc: MG132719
ORF ID: 10013

ORF full-length analysis tests

Clone type: Full Length
XGC accession: BC062509

Library Location

Plate ID: GDExt11001
Well Location: A05

EST Sequences

Clone: MGC:76136 IMAGE:5309397
Trimmed Sequence: ATGGCGGCGCCCCAGTGTCACGCTTTGGTACACCGGGTGTTAGCGGAGTGCCCAGTGACCAAGGCCCGGGCATGTGAGTTCCGCTTGCCCCATGGCCCAGTGAAGACTCCCGTGTTCATGCCCGTCGGCACACAGGGCACCATGAAGGGGGTGACGGCAGATCAGCTGCGGAATCTGGGCTGCGAGATCTGCCTGGGGAACACCTATCACCTCGGGATGCGCCCGGGTCCGGAGATTATGAAAAAGGCGGGCGGCCTGCATGGTTTTATGAACTGGGGCAGAAACCTCCTTACTGACAGCGGTGGGTTTCAGATGGTTTCCCTGGTGGAGTTGTCAAAAGTGACGGAAGAAGGGGTGCAGTTCAGATCTCCCTACGATGGGAAAGAGATCCTGCTCACCCCAGAAAAATCCATTGAAATCCAAAATGCACTGGGCTCTGATATTATGATGCAACTGGATGATGTGGTGAGCAGCACAATCACAGGCCCGCGTGTGGAGGAAGCCATGCACAGGTCTATCCGCTGGTTGGATCGATGTATTGCCGCCAACAGCAACCCCGATCGACAGAATCTCTTTGCCATCATCCAAGGAGGTCTGGATGCTGAACTGCGCAGGAAGTGTTTGCAGGAGATGACAAAACGGGACGTCCCCGGCTTTGCCATTGGTGGCCTAAGCGGAGGAGAAGAGAAAGATCACTTTTGGAGAATGGTGACCCTCAGCACTGACCATTTGCCTCGGGACAAACCTCGTTACCTTATGGGAGTGGGATATGCTACAGACCTTGTGGTATGTGTAGCTTTGGGCTGTGATATGTTTGACTGTGTCTTTCCAACAAGGACAGCTAGGTTCGGATCAGCGCTGGTTCCCTGGGGTTCCCTACAGCTAAAGAACAAACAGTTTGCTAAAGATTTCCAGCCCATAGACAAGAACTGTGATTGTCCCACGTGTCAGAGGTACAGCCGGGCCTACATCAATGCCTTATTTAAAAGTGACACTGCTGCTATGCACCATATTACAATCCATAACATTGCTTATCAGCTGAATCTGATGCGCTCGGTGAGGGACAGCATCCTGCAGGGCCGCTTCCCCCAGTTTGTGCAGGACTTTATGAGAACCATGTACAGCAGCAGAGACAAGTACCCCCAATGGGCTGTGGATGCTCTAGAGACAGTTGGTATCACCCTGCAGTGA
Full Trace Sequence: gtcatcgcgcattgggacgcaggctggcagcagactcaggaaacaaggaagtaatgcgagcgactgtggcgctggaacgcaaggagttgtttccgcgtctcaagggaaaaaaaatggcggcgccccagtgtcacgctttggtacaccgggtgttagcggagtgcccagtgaccaaggcccgggcatgtgagttccgcttgccccatggcccagtgaagactcccgtgttcatgcccgtcggcacacagggcaccatgaagggggtgacggcagatcagctgcggaatctgggctgcgagatctgcctggggaacacctatcacctcgggatgcgcccgggtccggagattatgaaaaaggcgggcggcctgcatggttttatgaactggggcagaaacctccttactgacagcggtgggtttcagatggtttccctggtggagttgtcaaaagtgacggaagaaggggtgcagttcagatctccctacgatgggaaagagatcctgctcaccccagaaaaatccattgaaatccaaaatgcactgggctctgatattatgatgcaactggatgatgtggtgagcagcacaatcacaggcccgcgtgtggaggaagccatgcacaggtctatccgctggttggatcgatgtattgccgccaacagcaaccccgatcgacagaatctctttgccatcatccaaggaggtctggatgctgaactgcgcaggaagtgtttgcaggagatgacaaaacgggacgtccccggctttgccattggtggcctaagcggaggagaagagaaagatcacttttggagaatggtgaccctcagcactgaccatttgcctcgggacaaacctcgttaccttatgggagtgggatatgctacagaccttgtggtatgtgtagctttgggctgtgatatgtttgactgtgtctttccaacaaggacagctaggttcggatcagcgctggttccctggggttccctacagctaaagaacaaacagtttgctaaagatttccagcccatagacaagaactgtgattgtcccacgtgtcagaggtacagccgggcctacatcaatgccttatttaaaagtgacactgctgctatgcaccatattacaatccataacattgcttatcagctgaatctgatgcgctcggtgagggacagcatcctgcagggccgcttcccccagtttgtgcaggactttatgagaaccatgtacagcagcagagacaagtacccccaatgggctgtggatgctctagagacagttggtatcaccctgcagtgatctctgtgctcttaggaacatggagtaaatctgcacattacctgttatgggcctttttataccacagaactgatactcaggccgggacccaatagccctgttgggctttaacttattgtctgaaatgttccgctcatagttccgttattctgtttttatcaattaccttttttttaagaacttttatttttaaataaaacgccaagtttttaaacaatcaaaaaaaaaaaaaaaaaaaaaaaaaaaa
Translation: MAAPQCHALVHRVLAECPVTKARACEFRLPHGPVKTPVFMPVGTQGTMKGVTADQLRNLGCEICLGNTYHLGMRPGPEIMKKAGGLHGFMNWGRNLLTDSGGFQMVSLVELSKVTEEGVQFRSPYDGKEILLTPEKSIEIQNALGSDIMMQLDDVVSSTITGPRVEEAMHRSIRWLDRCIAANSNPDRQNLFAIIQGGLDAELRRKCLQEMTKRDVPGFAIGGLSGGEEKDHFWRMVTLSTDHLPRDKPRYLMGVGYATDLVVCVALGCDMFDCVFPTRTARFGSALVPWGSLQLKNKQFAKDFQPIDKNCDCPTCQRYSRAYINALFKSDTAAMHHITIHNIAYQLNLMRSVRDSILQGRFPQFVQDFMRTMYSSRDKYPQWAVDALETVGITLQ
Donor tissue: gastrula