ORFeome > MGC76137 – XORFeome 2.0

MGC76137 – XORFeome 2.0

General Information

Species: Xenopus tropicalis hypothetical protein MGC76137, mRNA (cDNA clone MGC:76137 IMAGE:5309439), complete cds
Gene Symbol: MGC76137
Gene ID: 394706
ORF gb_acc: MG132740
ORF ID: 10040

ORF full-length analysis tests

Clone type: Full Length
XGC accession: BC062510

Library Location

Plate ID: GDExt11001
Well Location: H07

EST Sequences

Clone: MGC:76137 IMAGE:5309439
Trimmed Sequence: ATGCCTGGTCTGCTGCTAGGAGAAATCTTTCCTGACTTTGAGGCGGACACAACTATTGGCAGAATCAAGTTTCATGAATTCCTGGGGGGCTCATGGGGTGTTCTTTTCTCACACCCACGGGATTATACCCCTGTCTGCACCACCGAGCTAGGACGTTGTGTAAAGCTTGCTCCGGAGTTCAAAAAACGCAATGTTCGCATGATTGCCCTGTCAATAGACTCTGTAGAGGATCATCTCGGCTGGAGTAAGGACATCAACTCTTATAACTGTGATGAGCCCACAGAGACACTACCCTTTCCTATTATTGCTGATCCCAAACGGGATCTGGCTGTAAAACTTGGTATGCTTGATCCTGATGAGAAGGACATGCAGGGGATGCCAGTGACTGCAAGATGTGTTTTCATCATTGGCCCTGATAAGAAAATGAAGCTTTCTATTTTGTATCCAGCCACCACCGGAAGGAATTTTGATGAAATCCTAAGAGTCGTGGATTCCCTTCAACTGACTGCAGTCCATAATGTTGCGACTCCAGTGGATTGGAAGCCTGGTGATCGAGTCATGGTTCCCCCAAATGTTCCTGAAGAAGAAGCCAGTAAACTATATCCATCTGGCGTTTTTAACAAAGCGCTCCCTTCTCGCAAGAATTACCTGCGATACACTGCACACCCACAATAA
Full Trace Sequence: gcggctgcagccatgcctggtctgctgctaggagaaatctttcctgactttgaggcggacacaactattggcagaatcaagtttcatgaattcctggggggctcatggggtgttcttttctcacacccacgggattatacccctgtctgcaccaccgagctaggacgttgtgtaaagcttgctccggagttcaaaaaacgcaatgttcgcatgattgccctgtcaatagactctgtagaggatcatctcggctggagtaaggacatcaactcttataactgtgatgagcccacagagacactaccctttcctattattgctgatcccaaacgggatctggctgtaaaacttggtatgcttgatcctgatgagaaggacatgcaggggatgccagtgactgcaagatgtgttttcatcattggccctgataagaaaatgaagctttctattttgtatccagccaccaccggaaggaattttgatgaaatcctaagagtcgtggattcccttcaactgactgcagtccataatgttgcgactccagtggattggaagcctggtgatcgagtcatggttcccccaaatgttcctgaagaagaagccagtaaactatatccatctggcgtttttaacaaagcgctcccttctcgcaagaattacctgcgatacactgcacacccacaataagcagaaataaaatattttttgaatgatttactttatcaccaacagtagtgattcattcatatgcatgattgatcttctgaaggtagaatacttagtaaaagtccacaaaacagatgtatatcctgtgatttttttttttggtaaacataaacaactctggaatccatctggagagggtctaaaacatttgcacgcagcgtactgtcttgaaagagtctgttgacttctaggacaatggcacatgcagagatcaattgcctgtgtgaaatgtaatggtcctgttggtgacaagtgccagagaatacctttaactttgatagtatgggaattgctgcatcagattacattctgcttatgtcagattccattctgtaatctgacataaggtttaataaatttgggtttgatggcttatgaatgattttaaataaattccaatttccaatattctttcaactcctgttcaggtattttcctctagtgcctttcgagaaagccagcaggcacattattactttgccaaagattttattaatacctatgcatatgtgtgacaacattcttgcattcctcttgtaatcctttttttccctatgaaataaatcttgtatttgaattataaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaa
Translation: MPGLLLGEIFPDFEADTTIGRIKFHEFLGGSWGVLFSHPRDYTPVCTTELGRCVKLAPEFKKRNVRMIALSIDSVEDHLGWSKDINSYNCDEPTETLPFPIIADPKRDLAVKLGMLDPDEKDMQGMPVTARCVFIIGPDKKMKLSILYPATTGRNFDEILRVVDSLQLTAVHNVATPVDWKPGDRVMVPPNVPEEEASKLYPSGVFNKALPSRKNYLRYTAHPQ
Donor tissue: gastrula