ORFeome > MGC76224 – XORFeome 2.0

MGC76224 – XORFeome 2.0

General Information

Species: Xenopus tropicalis hypothetical protein MGC76224, mRNA (cDNA clone MGC:76224 IMAGE:5336468), complete cds
Gene Symbol: MGC76224
Gene ID: 394967
ORF gb_acc: MG132817
ORF ID: 10163

ORF full-length analysis tests

Clone type: Full Length
XGC accession: BC064243

Library Location

Plate ID: GDExt11002
Well Location: D06

EST Sequences

Clone: MGC:76224 IMAGE:5336468
Trimmed Sequence: ATGTTGGGGCTCTGGGGGCTGTTTTTCTTCCTGCTGGGATGTGTGCAAGGGGAGCCGGTCTGTTACGACAAGATCGGGTGTTTCAGCGACGAGAAACCATGGAGCGGAACGTTAGAGCGGCCAATAGCGAGGCTGCCCAGCTCCCCGGAACATATCAACACTCGCCTCTTATTGTTCACTAGAGAAAATGCTGAAAACTTCCAAGAGCTCCGCCCCTTGAACCCCTCGGCAGTGTCACTGACAAACTTCAAGACCAGCAGGAAGAGTCGATTTATTATCCACGGATTTATCGATGAGGGAGAGGAGAACTGGCTGGTGAATATGTGCAAAGCGATGTTGAAAGTCGAAGATGTGAACTGTTTCTGCACCGACTGGAGTGGGGGGTCCCGCACCATATACACCCAGGCCGCCAATAACATCCGTGTGGTGGGGGCGGAGCTGGCCTATTTTATTGGCTACCTCTCTAGCAAGATGAAATACCCTCTGTCCAACGTGCACATTATCGGCCACAGCTTGGGCTCTCACACTGCCGGGGAGGTTGGCAAGCGGATGCCCGGCATTGGGCGAATTACTGGGCTTGATCCGGCTGGGCCGTACTTCCAAAACACCCCCATCGAGGTCAGACTGGATCCAACCGATGCCGTCTTTGTAGATGCCATTCATACAGATACCGACCCGCTGATCCCCAAAATGGGTTATGGGATGAGCCAGTCAGTCGCACACATGGATTTCTTCCCTAACGGGGGCGAGAACATGCCGGGGTGCAGCAAACCCATCCTGGCCAAGCTCTTAGACATCGATGGACTCTGGGAAGGATCCAAGGATATATTTGCCTGTAACCACCTTAGAAGCTACAAATATTACACTGAAAGTATCTCGTCTCCCGATGGATTCGTTGGATACCCCAGCACTTCATATGAAGCATTTACAAAGGGTACCGGATTCCCATGTCCCACAACTGGTTGCCCATTAATGGGCCACTATGCCGACGCCTTTTCCAGCCATGGAACAAGCGACTATTCTTATTTCTTAAACACTGGAAGTGAAAAGCCTTATTCACGCTGGAGATACAGGGTCACCGTGAAGACCACTGGCAGCGTGAATTTCTTGGGATCTGTTCAAGTGTTGTTAAATGGCATTAAGGGCAGCACCAAAGGAGAAGAGATTGCCAGTGGGTTCATTAAACCCGGAAGCACCTACTCAGCCTTCATTGATGTCGAGGCCGATGTCGGACCCCTCATAACCGTGAGTTTCACCTGGAAAAAGAGTCTCATCAACCTCATTCCATTCACAGTCGGCGCCGAGATGATAACCGTGCAGTACGGGAAAGACGGACAGACATACGAGTTCTGTGGGAAAGACGCCGTGAGACCAAACAACCTTCAGAGCCTGACGTCTTGTTACTCGGCCACCAAATAA
Full Trace Sequence: gaaccatcacaagatgttggggctctgggggctgtttttcttcctgctgggatgtgtgcaaggggagccggtctgttacgacaagatcgggtgtttcagcgacgagaaaccatggagcggaacgttagagcggccaatagcgaggctgcccagctccccggaacatatcaacactcgcctcttattgttcactagagaaaatgctgaaaacttccaagagctccgccccttgaacccctcggcagtgtcactgacaaacttcaagaccagcaggaagagtcgatttattatccacggatttatcgatgagggagaggagaactggctggtgaatatgtgcaaagcgatgttgaaagtcgaagatgtgaactgtttctgcaccgactggagtggggggtcccgcaccatatacacccaggccgccaataacatccgtgtggtgggggcggagctggcctattttattggctacctctctagcaagatgaaataccctctgtccaacgtgcacattatcggccacagcttgggctctcacactgccggggaggttggcaagcggatgcccggcattgggcgaattactgggcttgatccggctgggccgtacttccaaaacacccccatcgaggtcagactggatccaaccgatgccgtctttgtagatgccattcatacagataccgacccgctgatccccaaaatgggttatgggatgagccagtcagtcgcacacatggatttcttccctaacgggggcgagaacatgccggggtgcagcaaacccatcctggccaagctcttagacatcgatggactctgggaaggatccaaggatatatttgcctgtaaccaccttagaagctacaaatattacactgaaagtatctcgtctcccgatggattcgttggataccccagcacttcatatgaagcatttacaaagggtaccggattcccatgtcccacaactggttgcccattaatgggccactatgccgacgccttttccagccatggaacaagcgactattcttatttcttaaacactggaagtgaaaagccttattcacgctggagatacagggtcaccgtgaagaccactggcagcgtgaatttcttgggatctgttcaagtgttgttaaatggcattaagggcagcaccaaaggagaagagattgccagtgggttcattaaacccggaagcacctactcagccttcattgatgtcgaggccgatgtcggacccctcataaccgtgagtttcacctggaaaaagagtctcatcaacctcattccattcacagtcggcgccgagatgataaccgtgcagtacgggaaagacggacagacatacgagttctgtgggaaagacgccgtgagaccaaacaaccttcagagcctgacgtcttgttactcggccaccaaataatctcagttatagaatataatgaataaaaaaatatttcttaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaa
Translation: MLGLWGLFFFLLGCVQGEPVCYDKIGCFSDEKPWSGTLERPIARLPSSPEHINTRLLLFTRENAENFQELRPLNPSAVSLTNFKTSRKSRFIIHGFIDEGEENWLVNMCKAMLKVEDVNCFCTDWSGGSRTIYTQAANNIRVVGAELAYFIGYLSSKMKYPLSNVHIIGHSLGSHTAGEVGKRMPGIGRITGLDPAGPYFQNTPIEVRLDPTDAVFVDAIHTDTDPLIPKMGYGMSQSVAHMDFFPNGGENMPGCSKPILAKLLDIDGLWEGSKDIFACNHLRSYKYYTESISSPDGFVGYPSTSYEAFTKGTGFPCPTTGCPLMGHYADAFSSHGTSDYSYFLNTGSEKPYSRWRYRVTVKTTGSVNFLGSVQVLLNGIKGSTKGEEIASGFIKPGSTYSAFIDVEADVGPLITVSFTWKKSLINLIPFTVGAEMITVQYGKDGQTYEFCGKDAVRPNNLQSLTSCYSATK
Donor tissue: tailbud