ORFeome > MGC76227 – XORFeome 2.0

MGC76227 – XORFeome 2.0

General Information

Species: Xenopus tropicalis hypothetical protein MGC76227, mRNA (cDNA clone MGC:89412 IMAGE:6989901), complete cds
Gene Symbol: MGC76227
Gene ID: 394895
ORF gb_acc: MG134352
ORF ID: 12038

ORF full-length analysis tests

Clone type: Full Length
XGC accession: BC084993

Library Location

Plate ID: GDExt11019
Well Location: C10

EST Sequences

Clone: MGC:89412 IMAGE:6989901
Trimmed Sequence: ATGAATAATCAAAAGCAACAAAAGCCAACGCTATCTGGCCAGCGTTTTAAAACCCGAAAAAGAGATGAAAAGGAGAGGTTTGATCCTACTCAATTCCAAGACTGCATTATTCAAGGCTTAAATGAAACTGGTAACGACTTGGAAGCAGTAGCAAAGTTTCTTGATGCTTCAGGGGCAAAGCTCGACTATCGGCGCTATGCAGAAACACTCTTTGACATTCTGGTGGCTGGCGGAATGCTGGCACCAGGCGGAACTTTGGCCGATGAGGTGATTCGCACTGATGTCTGTGTGTTTTCTGCACAAGAAGATCTTGAAACCATGCAGGCATTTGCTCAGGTTTTTAACAAGTTAATCAGACGCTACAAATACCTGGAGAAAGGCTTTGAAGAAGAGGTCAAAAAGCTGTTGCTGTTTCTGAAAGGTTTTTCAGAATCTGAGAGGAATAAGCTAGCTATGCTAACTGGTATTCTTTTGGCCAATGGGAATCTTTCCGCATCAATACTTAACAGTCTGTACAATGAAAACTTGGTCAAAGAAGGTGTTTCTGCAGCATTTGCAGTAAAACTGTTTAAATCATGGATTAATGAAAAAGATATCAATGCCGTTGCTGGTAGCCTCCGAAAAGTGAACATGGACAATAGGTTAATGGAACTTTTTCCTGCAAACAAGCAAACTGTAGAACACTTCACTAAATACTTTACTGATGCAGGATTAAAAGAATTGGCAGAATATGTCCGGAACCAGCAGACAATTGGTGCTCGCAAAGAGCTTCAAAAAGAGCTTCAGGAAATGATGTCACGTGGAGAACCTCTTAAAGAGATAAGTATGTACGTGAAAGATGAAATGAAGAAAAACAATATTTCTGAGCAAACTGTTATTGGTATCTTATGGTCCAGTGTAATGAGCTGCGTGGAATGGAATAAAAAGGAGGAGCTTGTTACAGAGCAAGCAATCAAACACTTGAAGCAATACAGCCCTCTCCTTGCTGCCTTTACAACACAAGGTCAGTCAGAACTGACTTTGCTGCTGAAAATTCAGGAGTATTGTTATGACAACATTCACTTCATGAAATCCTTCCAGAAAATAGTAGTGCTTTTTTATAAAGCTGAAGTTCTGAGTGAAGAACCCATTCTGAAGTGGTACAAAGATGCACATCTTGCAAAGGGAAAAAGTGTGTTCCTGGAGCAAATGAAAAAATTTGTTGAATGGCTTAAAAATGCAGAAGAAGAATCTGAATCGGAGACTGAAGAGGGTGATTGA
Full Trace Sequence: ctgatctatattcgggcatcttttttatgaataatcaaaagcaacaaaagccaacgctatctggccagcgttttaaaacccgaaaaagagatgaaaaggagaggtttgatcctactcaattccaagactgcattattcaaggcttaaatgaaactggtaacgacttggaagcagtagcaaagtttcttgatgcttcaggggcaaagctcgactatcggcgctatgcagaaacactctttgacattctggtggctggcggaatgctggcaccaggcggaactttggccgatgaggtgattcgcactgatgtctgtgtgttttctgcacaagaagatcttgaaaccatgcaggcatttgctcaggtttttaacaagttaatcagacgctacaaatacctggagaaaggctttgaagaagaggtcaaaaagctgttgctgtttctgaaaggtttttcagaatctgagaggaataagctagctatgctaactggtattcttttggccaatgggaatctttccgcatcaatacttaacagtctgtacaatgaaaacttggtcaaagaaggtgtttctgcagcatttgcagtaaaactgtttaaatcatggattaatgaaaaagatatcaatgccgttgctggtagcctccgaaaagtgaacatggacaataggttaatggaactttttcctgcaaacaagcaaactgtagaacacttcactaaatactttactgatgcaggattaaaagaattggcagaatatgtccggaaccagcagacaattggtgctcgcaaagagcttcaaaaagagcttcaggaaatgatgtcacgtggagaacctcttaaagagataagtatgtacgtgaaagatgaaatgaagaaaaacaatatttctgagcaaactgttattggtatcttatggtccagtgtaatgagctgcgtggaatggaataaaaaggaggagcttgttacagagcaagcaatcaaacacttgaagcaatacagccctctccttgctgcctttacaacacaaggtcagtcagaactgactttgctgctgaaaattcaggagtattgttatgacaacattcacttcatgaaatccttccagaaaatagtagtgcttttttataaagctgaagttctgagtgaagaacccattctgaagtggtacaaagatgcacatcttgcaaagggaaaaagtgtgttcctggagcaaatgaaaaaatttgttgaatggcttaaaaatgcagaagaagaatctgaatcggagactgaagagggtgattgaattgtattgttgttgtcagtaagcaaacacaggagctgtagataaaccttcatgtcccattctgccattgtgtcctgattcttacatcctacctcctgtatcaagcatgatataagggctttcatcatttcttttttttttttttcttttttttctttccccctgatcactactgtcaactttttttttttccctaaaaaaaaaagttttaagtagtaacaagctgtctagagctccgtttttttttttttttgtttttttttaccctctacctcctgtattttctactgtaataatgtaatttaaggcctttgaaaaattaacaattcgttttatcccttggttttctattaaaataaagtttaaaatcaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaa
Translation: MNNQKQQKPTLSGQRFKTRKRDEKERFDPTQFQDCIIQGLNETGNDLEAVAKFLDASGAKLDYRRYAETLFDILVAGGMLAPGGTLADEVIRTDVCVFSAQEDLETMQAFAQVFNKLIRRYKYLEKGFEEEVKKLLLFLKGFSESERNKLAMLTGILLANGNLSASILNSLYNENLVKEGVSAAFAVKLFKSWINEKDINAVAGSLRKVNMDNRLMELFPANKQTVEHFTKYFTDAGLKELAEYVRNQQTIGARKELQKELQEMMSRGEPLKEISMYVKDEMKKNNISEQTVIGILWSSVMSCVEWNKKEELVTEQAIKHLKQYSPLLAAFTTQGQSELTLLLKIQEYCYDNIHFMKSFQKIVVLFYKAEVLSEEPILKWYKDAHLAKGKSVFLEQMKKFVEWLKNAEEESESETEEGD
Donor tissue: gastrula