ORFeome > MGC76278 – XORFeome 2.0

MGC76278 – XORFeome 2.0

General Information

Species: Xenopus tropicalis hypothetical protein MGC76278, mRNA (cDNA clone MGC:76278 IMAGE:5379330), complete cds
Gene Symbol: MGC76278
Gene ID: 394875
ORF gb_acc: MG132802
ORF ID: 10139

ORF full-length analysis tests

Clone type: Full Length
XGC accession: BC064264

Library Location

Plate ID: GDExt11002
Well Location: B06

EST Sequences

Clone: MGC:76278 IMAGE:5379330
Trimmed Sequence: ATGCAATACAATAAGCAGGCCACAGAACAAGCCAAGGAGGAGATAAAGGCTGTGCTGGGTGTTTTAGATTCTCATCTGAAGACACGGACATTCCTAGTGGGCGAGAGGGTCACGCTGGCTGATATAGCAGTTACTTGCTCTCTTCTGTGGCTCTATAAGCAGGTCCTGGAACCATCCTTCCGCCAGCCATTTGGTAATGTTACAAGGTGGTTTGTGACCTGTGTGAATCAGCCAGAATTCCGTGCTGTGTTGGGAGAAGTCAAGCTTTGTGACAAGATGGCACAGTTTGATGCTAAGAAGTTTGCCGAGATGCAGCCCAAGAAAGAAACTCCCAAGAAAGAGAAGCCAGCAAAGGAGCCAAAAAAAGAAAAGGAGGAAAAGAAGAAGGCAACACCAGCTCCTGCTCCTGCCCCAGCCCCTGAGGATGATATGGATGAATCTGAAAAGGCTTTAGCAGCAGAGCCTAAATCAAAGGACCCATACGCACATCTACCTAAAAGCTCTTTTGTAATGGATGAGTTTAAGAGAAAATACTCTAATGAAGATACCCTGGCTGTAGCTCTGCCTTATTTCTGGGAGCACTTTGACAAGGAAGGCTGGTCCATCTGGTACGCTGAATACAAATTCCCCGAGGAGCTGACACAAACCTTCATGAGCTGCAACTTAATTACAGGTATGTTCCAGCGTCTAGACAAACTGCGCAAGACTGGCTTTGCCAGCGTCATCTTGTTTGGCACCAACAATGACAGCTCCATCTCCGGCGTGTGGGTGTTCAGGGGCCAGGACCTTGCATTCACACTCTCTGAAGACTGGCAAATTGACTATGAATCCTACACCTGGAGAAAGCTGGACAGCAATAGTGAGGAGTGCAAAACCCTGGTCAAAGAATACTTCTGCTGGGAGGGAGACTTCAAGCACGTGGGAAAGGCCTTTAACCAGGGCAAGATCTTCAAATGA
Full Trace Sequence: gtgaagatggccggcgggactctgtacacataccctgataactggagggcatacaagcccctcattgctgctcagtattcggggttccccatcaaggttgcctcctctcctccagaattccagtttggagtaacgaataagacatccgagttcctaaagaaattccccttaggcaaggtaccagcatttgagggcaacgacggtttttgcctttttgagagcagcgccattgctcattatggcattccttgtggcggaatgcatagaattgcactacaagacaaatgctgacttggagtctcagatttaaattggagagcatgtgagctctgagatgagctgtgaatctttatcattctacatcaagtgggcaatgatgagctccgaggaaccaatcgtttacaccaagctcaggtcatccagtgggtcagcttctcagacagtcacattgtccctccggccagcgcatgggtctttcccactctggggatcatgcaatacaataagcaggccacagaacaagccaaggaggagataaaggctgtgctgggtgttttagattctcatctgaagacacggacattcctagtgggcgagagggtcacgctggctgatatagcagttacttgctctcttctgtggctctataagcaggtcctggaaccatccttccgccagccatttggtaatgttacaaggtggtttgtgacctgtgtgaatcagccagaattccgtgctgtgttgggagaagtcaagctttgtgacaagatggcacagtttgatgctaagaagtttgccgagatgcagcccaagaaagaaactcccaagaaagagaagccagcaaaggagccaaaaaaagaaaaggaggaaaagaagaaggcaacaccagctcctgctcctgccccagcccctgaggatgatatggatgaatctgaaaaggctttagcagcagagcctaaatcaaaggacccatacgcacatctacctaaaagctcttttgtaatggatgagtttaagagaaaatactctaatgaagataccctggctgtagctctgccttatttctgggagcactttgacaaggaaggctggtccatctggtacgctgaatacaaattccccgaggagctgacacaaaccttcatgagctgcaacttaattacaggtatgttccagcgtctagacaaactgcgcaagactggctttgccagcgtcatcttgtttggcaccaacaatgacagctccatctccggcgtgtgggtgttcaggggccaggaccttgcattcacactctctgaagactggcaaattgactatgaatcctacacctggagaaagctggacagcaatagtgaggagtgcaaaaccctggtcaaagaatacttctgctgggagggagacttcaagcacgtgggaaaggcctttaaccagggcaagatcttcaaatgaggaggaggcgatctctgtccccctaaaatacgcgcagagtctggttttcacatccgtaccaacatccagagccttttaacttaacaagacagcaaacagaaaataaaaaactgaaatcaaaaccataaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaa
Translation: MQYNKQATEQAKEEIKAVLGVLDSHLKTRTFLVGERVTLADIAVTCSLLWLYKQVLEPSFRQPFGNVTRWFVTCVNQPEFRAVLGEVKLCDKMAQFDAKKFAEMQPKKETPKKEKPAKEPKKEKEEKKKATPAPAPAPAPEDDMDESEKALAAEPKSKDPYAHLPKSSFVMDEFKRKYSNEDTLAVALPYFWEHFDKEGWSIWYAEYKFPEELTQTFMSCNLITGMFQRLDKLRKTGFASVILFGTNNDSSISGVWVFRGQDLAFTLSEDWQIDYESYTWRKLDSNSEECKTLVKEYFCWEGDFKHVGKAFNQGKIFK
Donor tissue: tailbud