ORFeome > MGC76288 – XORFeome 2.0

MGC76288 – XORFeome 2.0

General Information

Species: Xenopus tropicalis hypothetical protein MGC76288, mRNA (cDNA clone MGC:76288 IMAGE:5379454), complete cds
Gene Symbol: MGC76288
Gene ID: 394497
ORF gb_acc: MG132864
ORF ID: 10220

ORF full-length analysis tests

Clone type: Full Length
XGC accession: BC061625

Library Location

Plate ID: GDExt11003
Well Location: E01

EST Sequences

Clone: MGC:76288 IMAGE:5379454
Trimmed Sequence: ATGGCTGCCGGTTGTTTAGTTGGGCAAAGGGCCGGTCCCTTATCGGATAAACTGTCCGGTTACTGCTGGGTTTTGCTGCCTCTTCTCTTAGTGGCGACTGCTCAAGCTTCTGTGTGTAGGCTCAAGACAGGAGATGGAAGAGATTCCGAAAGCTGTGGAACCAACCTTGAACTAGAGCATTCCTTTGAACTGGATGATAGCATCCATTTCAAAAAGAGGGGATCTTTGATCTGGAGTGGGACAGCCGAGCAAAGCATATCTATTCTGCAGAAGCAACTCACAGAAGATGAGAGAAACAAATTACGGGATATTGCAAACCTGAATGGGCTTTATCGAATTAGGGTTCCTAGAAAATTGGGTATTACAGAAGAAGCCAATGAATATGTCACATCCTTTGTCCGAGCATGTTCCATGGTCGAGTCCCATCTCTCTGACCAAATCAGCGTTCATACAGATATTTCAGGAAATGTCGTTGGCATTTCCATTGTGACTTTCCCTGGGTCCTGCAATGGTGCAGAGGTGGAGGATGTGGACCTGGAAATGTTCAACACTACTGTCTACATTCAGCAGCCAATAGCAGCAGCAGTACCCGAGACTGCAGCATTTATTGAACGCCTAGAGATGGAACAAGCCCAAAAAGCAAAGAATCCCCAAGAGCAGAAGTCATTCTTTGCCAAATATTGGATGTACATTATTCCCGTCGTGTTGTTCTTAATGATGTCTGGAGCGTCTGACGCTGGCAACCAAGGAGGCAATGGTGGAGGAGGCGGTGGCAGTGGGGGAGGAAGGTGA
Full Trace Sequence: ctctgtcatggctgccggttgtttagttgggcaaagggccggtcccttatcggataaactgtccggttactgctgggttttgctgcctcttctcttagtggcgactgctcaagcttctgtgtgtaggctcaagacaggagatggaagagattccgaaagctgtggaaccaaccttgaactagagcattcctttgaactggatgatagcatccatttcaaaaagaggggatctttgatctggagtgggacagccgagcaaagcatatctattctgcagaagcaactcacagaagatgagagaaacaaattacgggatattgcaaacctgaatgggctttatcgaattagggttcctagaaaattgggtattacagaagaagccaatgaatatgtcacatcctttgtccgagcatgttccatggtcgagtcccatctctctgaccaaatcagcgttcatacagatatttcaggaaatgtcgttggcatttccattgtgactttccctgggtcctgcaatggtgcagaggtggaggatgtggacctggaaatgttcaacactactgtctacattcagcagccaatagcagcagcagtacccgagactgcagcatttattgaacgcctagagatggaacaagcccaaaaagcaaagaatccccaagagcagaagtcattctttgccaaatattggatgtacattattcccgtcgtgttgttcttaatgatgtctggagcgtctgacgctggcaaccaaggaggcaatggtggaggaggcggtggcagtgggggaggaaggtgattgctatgaatggaaccttgatgtcccctttgagaatacactggcagcctttatcacagctggctatcaccagtgcatgtgaactgcattattttgttacatggagcacagcattccatttgccaccatctgcaagaagagagattcaatggatttgattgaaactaaacctaaaatgcaactttctttttatgaaaatgctcccagtagtagtcacaaatatatatacatgcaaaggtatcaggagcttgggaggatactgcagtatggatggggtcgtagggatcatttgtctactaaaggacacatcaagtgtgtctcctactcacaactgaatacttgctctttgctacatagtaactgtatacacatttgtcagagaatatatatttgtgaatgagatgcattttcatatgggctcaacttggattttagttttaatgatgcattaatttattaaaaactttggaattaaaaaaaaaaaaaaaaaaaaaaaaaaaaa
Translation: MAAGCLVGQRAGPLSDKLSGYCWVLLPLLLVATAQASVCRLKTGDGRDSESCGTNLELEHSFELDDSIHFKKRGSLIWSGTAEQSISILQKQLTEDERNKLRDIANLNGLYRIRVPRKLGITEEANEYVTSFVRACSMVESHLSDQISVHTDISGNVVGISIVTFPGSCNGAEVEDVDLEMFNTTVYIQQPIAAAVPETAAFIERLEMEQAQKAKNPQEQKSFFAKYWMYIIPVVLFLMMSGASDAGNQGGNGGGGGGSGGGR
Donor tissue: tailbud